You Searched For: CUSTOM BIOGENIC SYSTEMS, INC


2,094  results were found

SearchResultCount:"2094"

Sort Results

List View Easy View (new)

Rate These Search Results

Catalog Number: (103008-464)
Supplier: Anaspec Inc
Description: TRP-2, Tyrosinase-related Protein 2 (181-188), Purity: Greater than or equal to 95% (HPLC), Molecular weight: 1088.3, Sequence: VYDFFVWL, derived from tyrosinase-related protein 2 (TRP2) residues 181-188, Storage: -20 degree C, Size: 1mg


Catalog Number: (102999-026)
Supplier: Anaspec Inc
Description: TIP 39, Tuberoinfundibular Neuropeptide, tuberoinfundibular neuropeptide and parathyroid hormone 2, Purity: % Peak Area By HPLC >/=95%, Molecular Weight: 4504.3, Sequence: SLALADDAAFRERARLLAALERRHWLNSYMHKLLVLDAP, Storage:-20 deg C, Size: 1mg


Catalog Number: (103011-096)
Supplier: Anaspec Inc
Description: D-(-)-Luciferin potassium salt ≥95% (by HPLC), Ultrapure


Catalog Number: (102999-778)
Supplier: Anaspec Inc
Description: Human Biotin-Oxytocin, Biotin


Catalog Number: (103010-840)
Supplier: Anaspec Inc
Description: 6-TAMRA special formulation


Catalog Number: (103002-830)
Supplier: Anaspec Inc
Description: M13 Skeletal Muscle Myosin Light Chain Kinase Peptide


Catalog Number: (103007-276)
Supplier: Anaspec Inc
Description: Influenza Matrix Protein (62-70)


Catalog Number: (103006-660)
Supplier: Anaspec Inc
Description: OVA (323-339), amide peptide is amino acids 323 to 339 amidated fragment of ovalbumin (OVA), the H-2b-restricted OVA class II epitope, Purity: HPLC>/=95%, Sequence (One-Letter Code): ISQAVHAAHAEINEAGR-NH2, Molecular weight: 1773, Storage: -20 degree C, Size: 1 mg


Catalog Number: (103010-018)
Supplier: Anaspec Inc
Description: Human Protease Activated Receptor 1


Catalog Number: (102996-380)
Supplier: Anaspec Inc
Description: Biotin-Glucagon-Like Peptide 1, GLP-1 (7-36), amide, human, Purity: HPLC >/= to 95%, Molecular Weight: 3524, Sequence: Biotin-HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2, is labeled with biotin at the peptide N-terminus, Storage: -20 deg C, Size: 0.5 mg


Catalog Number: (103003-370)
Supplier: Anaspec Inc
Description: HNP-1, Defensin Human Neutrophil Peptide-1, Purity: HPLC >/- 95%, Molecular Weight: 3442.1, Sequence: ACYCRIPACIAGERRYGTCIYQGRLWAFCC, Mammalian defensins are abundant in the cytoplasmic azurophilic granules of neutrophils, Paneth cells of the small intestine, Size: 0.1 mg


Catalog Number: (103011-330)
Supplier: Anaspec Inc
Description: 2',7' - Dichlorodihydrofluorescein diacetate, Synonym: H2DCFDA, H2DCF DA, Cell-permeable substrate for fluorimetric detection of oxidases (including peroxidase), MW: 487.29, Spectral: Abs/Em = 495/529 nm, Solvent System: DMSO, Size: 100 mg


Catalog Number: (102999-354)
Supplier: Anaspec Inc
Description: [Gla17,21,24] - Osteocalcin (1 - 49), YLYQWLGAPVPYPDPL - Gla - PRR - Gla - VC - Gla - LNPDCDELADHIGFQEAYRRFYGPV (Gla=Y - Carboxyglutamic Acid, Disulfide bridge: 23 - 29), Molecular Weight: 5929.5, Storage: -20 deg C, Size: 0.1 mg


Catalog Number: (103003-266)
Supplier: Anaspec Inc
Description: Casein Kinase 2 (CK2) Substrate A-subunit, Purity: HPLC >/- 95%, Molecular Weight: 1264.2, Sequence: H-Arg-Arg-Arg-Asp-Asp-Asp-Ser-Asp-Asp-Asp-OH, Appearance: Powder, is unique among the protein kinases since it can use ATP as well as GTP, Size: 1 mg


Catalog Number: (103010-934)
Supplier: Anaspec Inc
Description: HiLyte* Fluor 555 acid, SE, Synonym: HiLyte* Fluor 555 acid, NHS ester, amine-reactive fluorescent labeling dye, Molecular Weight 1067.36, Spectral Properties: Abs/Em = 552/569 nm, Solvent System: DMF or DMSO, Physical State: Solid, Storage: -20 deg C, Size: 1 mg


Catalog Number: (103007-198)
Supplier: Anaspec Inc
Description: TP53 Q9NP68, p53 Mutant Form (372 - 389), Lys382 (Ac), Sequence: KKGQSTSRHK - K(Ac) - LMFKTEG, Molecular Weight: 2133.5, freely soluble in water, Apperance: Lyophilized white powder, Storage: -20 deg C, Size: 1 mg


Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
In order to process your orders without delay, we request that you provide the required business documentation to purchase this product.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • State issued document with your organization's Federal Tax ID Number
  • State issued document with your organization's Resale Tax ID Number
  • City or County issued Business License
  • State Department of Health Services License
  • Any other ID issued by the State that includes the business name and address

* Please note if your account is within the State of California two of these pieces of identification will be required.
VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
-239 - -224 of 2,094
no targeter for Bottom