2,094  results were found

SearchResultCount:"2094"

Sort Results

List View Easy View (new)

Rate These Search Results

Catalog Number: (103010-776)
Supplier: Anaspec Inc
Description: 5-FAM, SE, Synonym: 5-Carboxyfluorescein, succinimidyl ester; 5-FAM, NHS ester, Molecular Weight 473.39, Molecular Formula: C25H15NO9, Appearance: Orange solid, Purity: >90% (TLC), >90% (HPLC), Spectral Properties: Abs/Em = 492/518 nm, Solvent System: DMF or DMSO, Size: 100 mg


Catalog Number: (103003-174)
Supplier: Anaspec Inc
Description: Beta-Amyloid (1-40), Purity: HPLC >/- 95%, Molecular Weight: 4742.4, Sequence: TAMRA-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV, label: TAMRA, Appearance: Lyophilized red powder, this is a fluorescent labeled B-Amyloid peptide, Abs/Em=551/567 nm, Size: 0.1 mg


Catalog Number: (103011-376)
Supplier: Anaspec Inc
Description: Prodan, Synonym: 6 - Propionyl - 2 - dimethylaminonaphthalene, Environment-sensitive dye for studying membranes and structures of proteins, MW: 227.3, Spectral Properties: Abs/Em = 363/497 nm, Solvent System: DMF, Molecular Formula: C15H17NO, CAS No: 70504-01-7, Size: 25 mg


Catalog Number: (103011-196)
Supplier: Anaspec Inc
Description: Pluronic* F-127, 10% solution in water, Cell culture reagent for dissolving AM esters, Solution: solution, Storage: 4 degree C protected from light, Store away from oxidizing agent, Size: 100 mL


Catalog Number: (103011-146)
Supplier: Anaspec Inc
Description: BrdU, Synonym: 5 - Bromo - 2’ - deoxyuridine, Biomarker for cell cycle and cell proliferation, MW: 307.1, Spectral Properties: Abs/Em = ND/none nm, Solvent System: DMSO, Form: Solid, MF: C9H11BrN2O5, CAS No: 59-14-3, Storage -20 deg C desiccated and protected from light, Size: 25 mg


Catalog Number: (103005-964)
Supplier: Anaspec Inc
Description: Angiotensin I Converting Enzyme 2, ACE - 2/Caspase - 1 Substrate, Purity: By HPLC >/= 95%, MW: 1145.2, Sequence: (One-Letter Code): Mca-YVADAPK(Dnp), Physical State: Powder, Storage: -20 deg C, Size: 1 mg


Catalog Number: (103011-046)
Supplier: Anaspec Inc
Description: DABCYL acid, Synonym: 4-((4-(dimethylamino)phenyl)azo)benzoic acid, UltraPure Grade, acceptors for developing FRET-based nucleic acid probes and protease substrates, Molecular Weight: 269.3, Spectral Properties: Abs/Em = 425/none nm, Solvent System: DMF or DMSO, Size: 1g


Catalog Number: (103010-532)
Supplier: Anaspec Inc
Description: SensoLyte® 520 Cathepsin B Assay Kit *Fluorimetric*


Catalog Number: (103010-898)
Supplier: Anaspec Inc
Description: DEAC, acid, Synonym: 7-Diethylaminocoumarin-3-carboxylic acid, useful blue fluorescent building block for labeling amine-containing biomolecules, Molecular Weight: 261.27, Spectral Properties: Abs/Em = 432/472 nm, Solvent System: DMF or DMSO, Storage: -20 deg C, Size: 250 mg


Catalog Number: (103009-388)
Supplier: Anaspec Inc
Description: Des-gamma-carboxylated Osteocalcin/Bone Gla Protein, Purity: HPLC >/= 95%, MW: 5797.5, Sequence: [YLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV (Disulfide bridge:C23-29)] biotin - labeled, Store: -20 deg C, Size: 0.25mg


Catalog Number: (103011-050)
Supplier: Anaspec Inc
Description: DABCYL C2 maleimide, excellent thiol-reactive building block for developing DABCYL-based FRET probes, Purity: 95%, MW: 391.42, Spectral Properties: Abs/Em = 428/none nm, Solvent System: DMF or DMSO, Physical State: Solid, MF: C21H21N5O3, Storage -20 deg C, Size: 25 mg


Catalog Number: (103009-016)
Supplier: Anaspec Inc
Description: Histone H3 (1-8), Purity: Greater than or equal to 95% (HPLC), Molecular weight: 931.1, Sequence: ARTKQTAR, (Three-Letter Code) H-Ala-Arg-Thr-Lys-Gln-Thr-Ala-Arg-OH, This peptide corresponds to amino acid residues 1-8 of histone H3, Storage: -20 degree C, Size: 1mg


Catalog Number: (103006-688)
Supplier: Anaspec Inc
Description: OVA (323-339), TAMRA labeled class II (Kb)-restricted peptide epitope of OVA, an octameric peptide from ovalbumin, Purity: HPLC greater than or equal to 95%, Sequence (One-Letter Code): 5-TAMRA-ISQAVHAAHAEINEAGR, MW: 2186.4, Storage: -20 degree C, Size: 1 mg


Catalog Number: (103006-436)
Supplier: Anaspec Inc
Description: GIP (1 - 42), human, Purity: HPLC greater than or equal to 95%, Sequence (One-Letter Code): YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ, Molecular Weight: 4983.6, Appearance: Lyophilized white powder, Storage: -20 degree C, Size: 0.5mg


Catalog Number: (103007-324)
Supplier: Anaspec Inc
Description: PUMA BH3, Sequence: EEQWAREIGAQLRRMADDLNAQYER, Purity: By HPLC >/= 95%, This is a PUMA (p53 upregulated modulator of apoptosis) BH3 domain peptide, PUMA together with Bcl-xL, and cytoplasmic p53 coordinates p53 functions, Molecular Weight: 3049.3, Storage: -20 C, Size: 1 mg


Catalog Number: (102996-394)
Supplier: Anaspec Inc
Description: Glucagon-Like Peptide 1, GLP-1 amide, human, Purity: HPLC >/= to 95%, Molecular Weight: 4469.8, Sequence: FAM-HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2, label: FAM, This is fluorescent GLP-1 labeled at the peptide C-terminus with FAM, Abs/Em=494/521 nm, Size: 0.5 mg


Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
In order to process your orders without delay, we request that you provide the required business documentation to purchase this product.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • State issued document with your organization's Federal Tax ID Number
  • State issued document with your organization's Resale Tax ID Number
  • City or County issued Business License
  • State Department of Health Services License
  • Any other ID issued by the State that includes the business name and address

* Please note if your account is within the State of California two of these pieces of identification will be required.
VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
1 - 16 of 2,094
no targeter for Bottom