You Searched For: Hytest Ltd

Description: Linear C5a Receptor Antagonist, rat, human, Purity: Greater than or equal to 95% (HPLC), Molecular weight: 886.1, Sequence: FKP-(D-Cha)-Wr, linear peptide is derived from C-terminus of chemokine, complement fragment 5 anaphylatoxin, Storage: -20 deg C, Size: 1mg

Catalog Number: 103008-728

Supplier: Anaspec Inc

Sale

Description: Poly-Y-D-Glutamic Acid Construct, Sequence: Ac-(Y-e)15-C-NH2, Purity: By HPLC greater than or equal to 95%, capsule inhibits innate host defense through its antiphagocytic action, Molecular Weight: 2099, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103007-710

Supplier: Anaspec Inc

Sale

Description: SAM PEP 1, FAM labeled, AMPK substrate peptide, FAM labeled, Sequence: 5-FAM-HMRSAMSGLHLVKRR, Purity: HPLC >/= 95%, can be used as a substrate for APK in vitro kinase assays, Molecular Weight: 2137.5, Storage: -20 C, Size: 1 mg

Catalog Number: 103007-732

Supplier: Anaspec Inc

Sale

Description: [Lys(Me1)20]-Histone H4 (8-30)- WGK(Biotin); H4K20(Me1), Purity: HPLC >/= 95%, MW: 3156.7, Sequence: [Ac-KGLGKGGAKRHR-K(Me1)-VLRDNIQGIT-WGK(biotin)] amino acid residues 8-30 with a C-terminal WG linker biotin - labeled, Store: -20 deg C, Size: 1mg

Catalog Number: 103009-608

Supplier: Anaspec Inc

Sale

Description: Somatostatin 28, human, sheep, cow, rat, mouse, pig, Purity: HPLC >/= to 95%, Molecular Weight: 3148.6, Sequence: SANSNPAMAPRERKAGCKNFFWKTFTSC, is a cyclic peptide existing in two isoforms and is produced in the pancreas islet, Storage: -20 deg C, Size: 0.5 mg

Catalog Number: 102996-328

Supplier: Anaspec Inc

Sale

Description: 520 MMP FRET Substrate XI, Purity: % Peak Area By HPLC >/= 95%, MW: 1567.6, Sequence: (One-Letter Code): 5-FAM-P-Cha-G-Nva-HA-Dap(QXL* 520)-NH2 A sensitive substrate for assaying MMP-1, 2, 7, 8, 12 and 13 activities, Abs/Em = 494/521 nm, Size: 0.1 mg

Catalog Number: 103005-936

Supplier: Anaspec Inc

Sale

Description: PKG Substrate [RKRSRAE], Glasstide, Purity: HPLC >/- 95%, Molecular Weight: 902, is a selective substrate for protein kinase G (PKG) with a strong preference for PKG Ia, The Vmax/Km of the peptide substrate is significantly increased by peptide-546, Size: 1 mg

Catalog Number: 103003-092

Supplier: Anaspec Inc

Sale

Description: ACTH (1 - 39), human, cleavage product from a larger precursor proopiomelanocortin (POMC), Purity % Peak Area By HPLC >/=95%, Molecular Weight 4541.1, Sequence (One-Letter Code): SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF, Physical State: Powder, Storage -20 deg C, Size: 1mg

Catalog Number: 102998-422

Supplier: Anaspec Inc

Sale

Description: TAT (47-57), FAM-labeled fluorescent, Absorbance /Em = 494/521 nm, Purity: HPLC greater than or equal to 95%, Sequence (One-Letter Code): FAM-YGRKKRRQRRR, Molecular Weight: 1918.2, Physical State: Solid, Storage: -20 degree C, Size: 1 mg

Catalog Number: 103006-418

Supplier: Anaspec Inc

Sale

Description: SensoLyte* Homogeneous Rh110 Caspase-3/7 Assay Kit, Components: Rh110 Caspase-3/7 substrate 250 ul, Rh110 1 mM DMSO solution, 40 ul, Ac-DEVD-CHO 5 mM DMSO solution, 10 ul, Assay buffer 30 mL, DTT 1 M, 1.1 mL, 10X Lysis Buffer 20 mL

Catalog Number: 103010-170

Supplier: Anaspec Inc

Sale

Description: T20 36-residue peptide corresponds to aa 643-678 of the C-terminus of HIV-1LAIgp41. It strongly inhibits HIV-1 viral fusion with an EC50 of 1 ng/ml, Purity: HPLC>/=95%, Sequence (One-Letter Code): Ac-YTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWF-NH2, Molecular weight: 4492, Size: 1 mg

Catalog Number: 103006-446

Supplier: Anaspec Inc

Sale

Description: ACTH (1-17), Purity: HPLC >/- 95%, Molecular Weight: 2093.4, Sequence: H-Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-OH, Appearance: Powder, ACTH (1–17), and aMSH, both derived from POMC are involved in melanogenesis, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103003-356

Supplier: Anaspec Inc

Sale

Description: MOG (35-55), mouse, rat, Purity: Greater than or equal to 95%(By HPLC), Molecular weight: 2582, Sequence: MEVGWYRSPFSRVVHLYRNGK (1-letter code), member of the immunoglobulin superfamily and is expressed in central nervous system (1-3), Storage: At -20 Degree C, Size: 10mg

Catalog Number: 103002-982

Supplier: Anaspec Inc

Sale

Description: Histone H3 (1-21), Biotinylated, used to investigate the mechanisms of ethanol-induced histone H3 acetylation in rat hepatocytes, Purity: HPLC >/=95%, Sequence (1-Letter Code): ARTKQTARKSTGGKAPRKQLA-GG-K(BIOTIN)-NH2, MW: 2723.2, Storage: -20degree C, Size: 1mg

Catalog Number: 103006-912

Supplier: Anaspec Inc

Sale

Description: Glucagon-Like Peptide 1, GLP-1 (7-36), amide, human, Purity: HPLC >/= to 95%, Molecular Weight: 3297.7, Sequence: HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2, Appearance: Lyophilized white powder, This peptide shares sequence with preproglucagon, Storage: -20 deg C, Size: 1 mg

Catalog Number: 102996-228

Supplier: Anaspec Inc

Sale

Description: 5(6)-TAMRA, SE, Synonym: 5-(and-6)-Carboxytetramethylrhodamine, succinimidyl ester; 5(6)-TAMRA, NHS ester, for preparing peptide, protein, nucleotide, nucleic acid conjugates, Molecular Weight: 527.53, Molecular Formula: C29H25N3O7, Appearance: Dark red solid, Size: 100 mg

Catalog Number: 103010-846

Supplier: Anaspec Inc

Sale