You Searched For: Hytest Ltd

Description: Human MMP-1 (Recombinant, Catalytic Domain), Matrix metalloproteinases, Source: E. Coli, Purity: Greater than 95% as determined by SDS-PAGE, corresponding to the catalytic domain (aa 106-261), 17.5 kDa, Storage: -80 degree C, Size: 1ug

Catalog Number: 103001-682

Supplier: Anaspec Inc

Sale

Description: Human Platelet Factor IV 18, C18G, Sequence: ALYKKLLKKLLKSAKKLG, Purity: By HPLC greater than or equal to 95%, C18G is a synthetic A-helical peptide derived from human platelet factor IV, Molecular Weight: 2043.7, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103007-328

Supplier: Anaspec Inc

Sale

Description: NFF-3, Purity: HPLC >/= 95%, Molecular Weight: 1675.9, Sequence: Mca-Arg-Pro-Lys-Pro-Val-Glu-Nva-Trp-Arg-Lys(Dnp)-NH2, Appearance: Lyophilized yellow powder, is hydrolyzed rapidly by MMP, has important applications for the differentiation of MMP-3 activity, Size: 1 mg

Catalog Number: 102996-800

Supplier: Anaspec Inc

Sale

Description: Elastin, FITC Conjugated, soluble bovine neck ligament elastin, heavily labeled with FITC, conjugate's fluorescence is quenched, Spectral property : Abs/Em = 492/515 nm, Solvent System: Water, Fluorescence: Excitation/Emission wavelength= 490 nm/520 nm, Size: 1 mg

Catalog Number: 103011-296

Supplier: Anaspec Inc

Sale

Description: SensoLyte* Anti-Human MOG (1-125) Human IgG Specific ELISA Kit, Optimized to detect anti-human MOG (1-125) IgG in human samples, Wells are pre-coated with recombinant human MOG, Storage: At 2-8 degree C, Size: One 96-well strip plate

Catalog Number: 103001-242

Supplier: Anaspec Inc

Sale

Description: Beta-Amyloid (42-1), Human, Sequence: AIVVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD, Purity: Peak Area By HPLC greater than or equal to 95%, Molecular Weight: 4514.1, Appearance: Lyophilized white powder, Storage: -20 degree C, Size: 0.1 mg

Catalog Number: 103000-624

Supplier: Anaspec Inc

Sale

Description: [Lys(Ac)27]-Histone 3 (21-44)-GK(Biotin); H3K27(Ac), Purity: Greater than or equal to 95% (HPLC), Molecular weight: 2974.5, Sequence: ATKAAR-K(Ac)-SAPSTGGVKKPHRYRPG-GK(Biotin)-NH2, Label: Biotin, Storage: -20 degree C, Size: 1mg

Catalog Number: 103008-116

Supplier: Anaspec Inc

Sale

Description: NDA, Synonym: Naphthalene - 2,3 - dicarboxaldehyde, Fluorogenic indicator for primary amino group; Widely used for quantitation of peptides and proteins, MW: 184.2, Spectral Properties: Abs/Em = 419/493 nm, Solvent System: DMSO or DMF, MF: C12H8O2, CAS no: 70848-82-7, Size: 100mg

Catalog Number: 103011-112

Supplier: Anaspec Inc

Sale

Description: Streptavidin, nonglycosylated, tetrameric protein, 55,000-dalton, with each subunit able to bind a single molecule of the vitamin biotin, purified from Streptomyces avidinii, Physical State: Lyophilized powder, Solvent System: water, Storage -20 deg C desiccated, Size: 100mg

Catalog Number: 103005-958

Supplier: Anaspec Inc

Sale

Description: Pp60(v-SRC) Autophosphorylation Site, Phosphorylated, Purity: HPLC >/= 95%, Molecular Weight: 1672.7, Sequence: H-Arg-Arg-Leu-Ile-Glu-Asp-Asn-Glu-pTyr-Thr-Ala-Arg-Gly-OH, These sequences correspond to the tyrosine phosphorylation site, Size: 1mg

Catalog Number: 102996-272

Supplier: Anaspec Inc

Sale

Description: Protease-Activated Receptor-1, PAR-1 Agonist, amide, Sequence: TFLLRNPNDK-NH2, Purity: By HPLC greater than or equal to 95%, peptide is a thrombin receptor activating peptide, Molecular Weight: 1216.4, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103007-556

Supplier: Anaspec Inc

Sale

Description: Atrial Natriuretic Peptide(1-28), Purity: HPLC >/= to 95%, Molecular Weight: 3080.5, Sequence: H-Ser-Leu-Arg-Arg-Ser-Ser-Cys-Phe-Gly-Gly-Arg-Met-Asp-Arg-Ile-GlyAla-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe, Appearance: Lyophilized white powder, Size: 0.5 mg

Catalog Number: 102996-074

Supplier: Anaspec Inc

Sale

Description: Beta-Amyloid (9-42), Human, Purity: Greater than or equal to 95%( % Peak Area By HPLC), Molecular weight: 3556.2, Sequence: GYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA (One-Letter Code), Appearance: Lyophilized white powder, Storage: At -20 Degree C, Size: 1mg

Catalog Number: 103002-968

Supplier: Anaspec Inc

Sale

Description: Secretin, rat, Purity: HPLC >/- 95%, Molecular Weight: 3028.7, Sequence: HSDGTFTSELSRLQDSARLQRLLQGLV-NH2, is a 27-amino acid gastrointestinal peptide hormone, has been implicated in numerous regulatory events involving the pancreas, biliary tree, stomach, Size: 1 mg

Catalog Number: 103003-340

Supplier: Anaspec Inc

Sale

Description: alpha-Mating Factor Pheromone, yeast, Purity: Greater than or equal to 95%(By HPLC), Molecular weight: 1684, Sequence: WHWLQLKPGQPMY, tridecapeptide, an alpha-factor pheromone of Saccharomyces cerevisiae, induces conjugation, Storage: At -20 degree C, Size: 5mg

Catalog Number: 103003-004

Supplier: Anaspec Inc

Sale

Description: 5 - TAMRA, Special Formulation, purified single isomer, Synonym: 5-Carboxytetramethylrhodamine, Molecular Weight: 430.45 (Free Acid), Spectral Properties: Abs/Em = 541/568 nm, Solvent System: DMF or DMSO, Appearance: Dark red solid, Storage -20 deg C, Size: 10mg

Catalog Number: 103010-834

Supplier: Anaspec Inc

Sale