2,094  results were found

SearchResultCount:"2094"

Sort Results

List View Easy View (new)

Rate These Search Results

Catalog Number: (103010-636)
Supplier: Anaspec Inc
Description: SensoLyte* Thioflavin T B-Amyloid (1-42) Aggregation Kit, Components: Assay Buffer 25 ml, Beta-Amyloid (1-42) (AB42), human 0.5 mg (2 x 0.25 mg), Thioflavin T 20 mM, 100 ul, Morin 10 mM, 25 ul, Phenol Red 10 mM, 25 ul, storage: -20 deg C


Catalog Number: (102996-492)
Supplier: Anaspec Inc
Description: Neurotensin, Purity: HPLC >/= 95%, Molecular Weight: 1673, Sequence: Pyr-Leu-Tyr-Glu-Asn-Lys-Pro-Arg-Arg-Pro-Tyr-Ile-Leu-OH, Appearance: Powder, Storage: -20 deg C, Size: 25 mg


Catalog Number: (103001-690)
Supplier: Anaspec Inc
Description: Human MMP-9 (Recombinant, Catalytic Domain), Matrix metalloproteinases, Source: E. Coli, Purity: Greater than 95% as determined by SDS-PAGE, corresponding to the catalytic domain (aa 112-445), 40 kDa, Storage: -80 degree C, Size: 10ug


Catalog Number: (103007-796)
Supplier: Anaspec Inc
Description: Laminin A1 (2110-2127), amide, mouse, Sequence: CSRARKQAASIKVAVSADR-NH2, Purity: By HPLC greater than or equal to 95%, This peptide is derived from mouse laminin A1 amino acid residues 2110-2127, Molecular Weight: 2016.4, Storage: -20 deg C, Size: 1 mg


Catalog Number: (103010-758)
Supplier: Anaspec Inc
Description: 5-FAM, single isomer, Synonym: 5-Carboxyfluorescein, Molecular Weight: 376.32, Molecular Formula: C21H12O7, Appearance: Orange solid, Purity: >95% (TLC), >95% (HPLC), Spectral Properties Abs/Em = 492/518 nm, Solvent System DMF or DMSO, Storage: -20 deg C desiccated, Size: 5g


Catalog Number: (103010-754)
Supplier: Anaspec Inc
Description: 5-FAM, single isomer, Synonym: 5-Carboxyfluorescein, Molecular Weight: 376.32, Molecular Formula: C21H12O7, Appearance: Orange solid, Purity: >95% (TLC), >95% (HPLC), Spectral Properties Abs/Em = 492/518 nm, Solvent System DMF or DMSO, Storage: -20 deg C desiccated, Size: 100 mg


Catalog Number: (103000-576)
Supplier: Anaspec Inc
Description: FITC-LC-TAT (47 - 57), Sequence (One-Letter Code): FITC-LC-YGRKKRRQRRR-NH2, Peptide Purity: >95%, Appearance: Lyophilized yellow powder, Molecular Weight: 2061.4, peptide contains a long chain (LC) to prevent FITC from degradation. Abs/Em = 493/522 nm, Size: 0.5 mg


Catalog Number: (103006-340)
Supplier: Anaspec Inc
Description: Apelin - 36, human, peptide, inhibits infection of APJ-expressing cells by a diverse group of primary HIV-1 viruses, Purity: HPLC >/= 95%, Sequence (One-Letter Code): LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF, MW: 4195.9, Physical State: Powder, Storage: -20 degree C, Size: 1 mg


Catalog Number: (103008-254)
Supplier: Anaspec Inc
Description: Bak BH3 peptide, TAMRA-labeled, Purity: Greater than or equal to 95% (HPLC), Molecular weight: 2137.4, Sequence: 5-TAMRA-GQVGRQLAIIGDDINR, derived from the BH3 domain of Bak, has high-affinity binding to surface pocket of Bcl-XL protein, Storage: -20 degree C, Size: 1mg


Catalog Number: (103008-584)
Supplier: Anaspec Inc
Description: Bac2A; Bactenecin 2A, Purity: Greater than or equal to 95% (HPLC), Molecular weight: 1420.8, Sequence: RLARIVVIRVAR-NH2, peptide a linear variant of loop-shaped cationic antimicrobial peptide Bactenecin found in bovine neutrophils, Storage: -20 degree C, Size: 1mg


Catalog Number: (103010-850)
Supplier: Anaspec Inc
Description: 5-TAMRA, SE, Synonym: 5-Carboxytetramethylrhodamine, succinimidyl ester; 5-TAMRA, NHS ester, for labeling proteins, single isomers for labeling peptides, nucleotides, Molecular Weight: 527.53, Molecular Formula: C29H25N3O7, Spectral Properties: Abs/Em = 547/574 nm, Size: 100mg


Catalog Number: (102996-438)
Supplier: Anaspec Inc
Description: H-Ala-Pro-AFC, Purity: HPLC >/= to 95%, Molecular Weight: 397.2, Sequence: AP-AFC, Appearance: powder, This is a fluorescent peptide, Storage: -20 deg C, Size: 10 mg


Catalog Number: (103008-238)
Supplier: Anaspec Inc
Description: Beta-CGRP, human, Purity: Greater than or equal to 95% (HPLC), Molecular weight: 3793.4, Sequence: ACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKAF-NH2 (Disulfide bridge: 2-7), 37-amino acid peptide is beta form of Calcitonin-gene-related peptide (Beta-CGRP), Storage: -20 degree C, Size: 0.5mg


Catalog Number: (103001-342)
Supplier: Anaspec Inc
Description: SensoLyte* Anti-PLP (139-151) IgG Quantitative ELISA Kit(Mouse) Colorimetric, determine anti-PLP (139-151) IgG antibody, Wells are pre-coated with PLP peptide and pre-blocked with BSA, Storage: 2-8 degree C, Size: One 96-well strip plate


Catalog Number: (103008-008)
Supplier: Anaspec Inc
Description: [Lys(Me3)27]-Histone H3 (21-44)-GK,Biotin


Catalog Number: (103009-982)
Supplier: Anaspec Inc
Description: Mouse P0 (180-199)


Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
In order to process your orders without delay, we request that you provide the required business documentation to purchase this product.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • State issued document with your organization's Federal Tax ID Number
  • State issued document with your organization's Resale Tax ID Number
  • City or County issued Business License
  • State Department of Health Services License
  • Any other ID issued by the State that includes the business name and address

* Please note if your account is within the State of California two of these pieces of identification will be required.
VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
-63 - -48 of 2,094
no targeter for Bottom