You Searched For: Hytest Ltd

Catalog Number: (103008-186)

Supplier: Anaspec Inc

Description: This is a monomethylated lysine at position 4 of the 1-21 amino acid histone H3 peptide. This form of histone methylation is characterized as being enriched around transcription start sites. It’s chromatin mark was also closely correlated to cell-type specific expression of putative gene targets of enhancers. It was also noted from a genome wide study that most potential regulatory elements were enriched only by the mono-methylated version of this histone 3.
Sequence:ART-K(Me1)-QTARKSTGGKAPRKQLA
MW:2268.6 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Catalog Number: (103009-742)

Supplier: Anaspec Inc

Description: TAU proteins belong to the microtubule-associated protein (MAP) family and are involved in the pathogenesis of Alzheimer’s disease. In the human brain, there are six TAU isoforms ranging from 352 to 441 amino acids in length. These isoforms vary at the carboxyl terminal according to the presence of either three repeat or four repeat domains (R1-R4), in addition to the presence or absence of one or two insert domains at the amino-terminus. Tau Peptide (306-336) is a 31-amino acid long peptide derived from the Repeat 3 domain.
Sequence:VQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQ
MW:3248.51 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Catalog Number: (103011-236)

Supplier: Anaspec Inc

Description: HiLyte™ Fluor 405 is a blue fluorescent dye with Ex/Em = 404/428 nm, spectrally similar to Alexa Fluor™ 405 and DyLight Fluor™ 405 dyes.

Sale

Catalog Number: (103006-914)

Supplier: Anaspec Inc

Description: This sequence corresponds to the N-terminus of histone H3, spanning amino acids 1 to 25, amidated. Histones are small proteins (11–22 kDa) that mediate the folding of DNA into chromatin.
Sequence:ARTKQTARKSTGGKAPRKQLATKAA-NH2
MW:2625.1 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Catalog Number: (103007-352)

Supplier: Anaspec Inc

Description: This is amino acids 22 to 41 fragment of beta-amyloid peptide, biotinylated through an LC spacer at the N-terminus.
Sequence: Biotin-LC-EDVGSNKGAIIGLMVGGVVI
Molecular Weight: 2267.8 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Sale

Catalog Number: (103008-102)

Supplier: Anaspec Inc

Description: Mant-ATP is a fluorescent analog of ATP with Ex/Em = 355/448 nm. The fluorescence quantum yield of Mant fluorophore is 0.2 in water which increases significantly in nonpolar solvents or upon binding to most proteins. This highly environmental sensitive fluorescence of Mant makes Mant-ATP useful for directly detecting the nucleotide-protein interactions.

Sale

Catalog Number: (103008-100)

Supplier: Anaspec Inc

Description: Mant-GTP is a fluorescent analog of GTP with Ex/Em = 355/448 nm. The fluorescence quantum yield of Mant fluorophore is 0.2 in water which increases significantly in nonpolar solvents or upon binding to most proteins. This highly environmental sensitive fluorescence of Mant makes Mant-GTP useful for directly detecting the nucleotide-protein interactions.

Sale

Catalog Number: (103007-416)

Supplier: Anaspec Inc

Description: This proline-rich cationic antibacterial peptide pyrrhocoricin kills responsive bacteria by binding to the 70 kDa heat shock protein DnaK and inhibiting protein folding.
Sequence:VDKGSYLPRPTPPRPIYNRN
MW:2340.7 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Catalog Number: (103003-348)

Supplier: Anaspec Inc

Description: The fibrinopeptide B is an N-terminal modified peptide with pyroglutamylation, one of the common post-translational process. After cleaving off FPA in the conversion of soluble fibrinogen to fibrin, thrombin then releases fibrinopeptide B (FPB) from the beta-chains of the fibrin I subunits to form fibrin II polymers, which associate and cross-links to form a semi-solid network, while the fibrinopeptides remain soluble in plasma. Fibrin formation associated with active thrombosis leads to significantly higher plasma levels of FPB and thus measurement of plasma FPB levels is a more sensitive and specific serologic marker for acute thrombosis.
Sequence:Pyr-GVNDNEEGFFSAR
MW:1553.6 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Sale

Catalog Number: (103007-368)

Supplier: Anaspec Inc

Description: Delta -Lysin is a 26-residue hemolytic peptide secreted by Staphylococcus aureus, it is a delta-toxin. It is produced by most of the strains of S. aureus. This toxin is lytic to many kinds of cells by solubilization of their membranes.
Sequence:MAQDIISTIGDLVKWIIDTVNKFTKK
MW:2978.6 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Catalog Number: (102998-430)

Supplier: Anaspec Inc

Description: Corticotropin-inhibiting peptide (CIP), the 7-38 fragment of human ACTH (1-39), is known to act as an antagonist of ACTH receptors. It does not have any corticosteroidogenic activity.
Sequence: FRWGKPVGKKRRPVKVYPNGAEDESAEAFPLE
MW: 3659.2 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C

Sale

Supplier: Anaspec Inc

Description: PYY is a 36-amino acid regulatory gut hormone present in endocrine cells in the intestine. This peptide acts both as an endocrine and a paracrine agent.
Sequence:YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2
MW:4309.8 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (102997-266)

Supplier: Anaspec Inc

Description: This peptide is beta-amyloid (1-40) N-terminally truncated. It was shown that supplementing the media with N-terminally truncated Abeta (2-40) and (2-42) induce the phagocytosis of polystyrene particles by primary human monocytes. N-terminally truncated Aβ(x–42) induced the phagocytosis of PSPs significantly more effectively than did Aβ(x–40).
Sequence: AEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Molecular Weight: 4214.8 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Sale

Catalog Number: (103007-806)

Supplier: Anaspec Inc

Description: Myelin oligodendrocyte glycoprotein (MOG) is a member of the immunoglobulin superfamily and is expressed exclusively in the central nervous system. It is a glycoprotein observed to be important in the myelination of nerves. It is a central molecule actively studied for its role in Multiple Sclerosis. MOG (35-55) is able to induce autoantibody production and relapsing-remitting neurological disease causing extensive plaque-like demyelination. Autoantibody response to MOG (35-55) has been observed in multiple sclerosis (MS) patients and MOG (35-55)-induced experimental autoimmune encephalomyelitis (EAE) C57/BL6 mice and Lewis rats.
Sequence: MEVGWYRPPFSRVVHLYRNGK
MW: 2592 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C

Sale

Catalog Number: (103011-028)

Supplier: Anaspec Inc

Description: 5(6)-TAMRA cadaverine is a useful reagent for modifying carboxy groups via EDC-mediated reactions. It is a good glutamate transglutaminase substrate and a useful building block for small fluorescent molecules.

Sale

Catalog Number: (103006-690)

Supplier: Anaspec Inc

Description: Caloxin 1b1 is obtained by screening for binding to extracellular domain 1 of PMCA4, which inhibited PMCA extracellularly, selectively, and had a higher affinity for PMCA4 than PMCA1. Because caloxin 1b1 had been selected to bind to an extracellular domain of PMCA, it could be added directly to cells and tissues to examine its effects on smooth muscle and endothelium.
Sequence:TAWSEVLHLLSRGGG
MW:1582.8 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale