Human Peptide YY

Supplier: Hytest Ltd
Ratings: (No Reviews)

Total Ratings: 0
Avg. Ratings: 0.0 out of 5

AS-24401 AS-24402
102996-558EA 306.92 USD
102996-558 102996-560
Human Peptide YY
Proteins and Peptides

PYY is a 36-amino acid regulatory gut hormone present in endocrine cells in the intestine. This peptide acts both as an endocrine and a paracrine agent.
Sequence:YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2
MW:4309.8 Da
% peak area by HPLC:95
Storage condition:-20° C

Order Now


Learn more

About VWR

Avantor is a vertically integrated, global supplier of discovery-to-delivery solutions for...

Learn more About VWR