You Searched For: brain4


11,900  results were found

SearchResultCount:"11900"

Sort Results

List View Easy View (new)

Rate These Search Results

Catalog Number: (10075-702)
Supplier: Prosci
Description: Synapsin I plays a key role in synaptic plasticity in brain. This effect is due in large part to the ability of the synapsins to regulate the availability of synaptic vesicles for release. In addition to its role in plasticity, the expression of synapsin I is a precise indicator of synapse formation. Thus synapsin I immunocytochemistry provides a valuable tool for the study of synaptogenesis. The role of synapsin in synaptic plasticity and in synaptogensis is regulated by phosphorylation.


Catalog Number: (103229-514)
Supplier: Novus Biologicals
Description: DMBT1/GP340 Polyclonal Antibody, Host: Goat, Species reactivity: Mouse, Isotype: IgG, Immunogen: E. Coli-derived recombinant mouse DMBT1 Trp215-Gly420, synonyms: deleted in malignant brain tumors 1 protein, CRP-ductin, Application: WB, Size: 100UG


Catalog Number: (10474-136)
Supplier: Bioss
Description: This gene is a member of the brain expressed X-linked gene family. The proteins encoded by some of the other members of this family act as transcription elongation factors which allow RNA polymerase II to escape pausing during elongation. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Aug 2011].[SUBCELLULAR LOCATION] [PTM] [SIMILARITY]


Catalog Number: (103229-516)
Supplier: Novus Biologicals
Description: DMBT1/GP340 Polyclonal Antibody, Host: Goat, Species reactivity: Mouse, Isotype: IgG, Immunogen: E. Coli-derived recombinant mouse DMBT1 Trp215-Gly420, synonyms: deleted in malignant brain tumors 1 protein, CRP-ductin, Application: WB, Size: 25UG


Catalog Number: (102880-794)
Supplier: R&D Systems
Description: Oligodendrocyte Marker O4, monoclonal antibody, Host: Mouse, Clone: O4, Isotype: IgM, Species reactivity: Human, Mouse, Rat, Chicken, Format: Alexa Fluor 488, Immunogen: Bovine brain corpus callosum white matter, Size: 100 tests


Catalog Number: (103007-598)
Supplier: Anaspec Inc
Description: This is amino acids 11 to 42 fragment of beta-amyloid. This peptide was detected in Alzheimer disease brains within several principal beta-amyloid variants.
Sequence: EVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Molecular Weight: 3335.9 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C


Catalog Number: (10260-356)
Supplier: Bioss
Description: BSMAP is a 342 amino acid type-I membrane glycoprotein that localizes to organelle membranes and belongs to the TMEM59 family. Expressed at high levels in brain tissue, BSMAP is thought to play a role in brain function and central nervous system activity. The gene encoding BSMAP maps to human chromosome 19, which consists of over 63 million bases, houses approximately 1,400 genes and is recognized for having the greatest gene density of the human chromosomes. It is the genetic home for a number of immunoglobulin (Ig) superfamily members, including the killer cell and leukocyte Ig-like receptors, a number of ICAMs, the CEACAM and PSG family and Fc receptors (FcRs).


Supplier: Bachem Americas
Description: A tetradecapeptide isolated from amphibian skin, which is biologically active in both the central nervous system and gastrointestinal tract. It was also shown that bombesin suppresses feeding in rats. Bombesin-like peptides have been biochemically characterized in rat brain.

Catalog Number: (75908-706)
Supplier: Biotium
Description: CD90 Monoclonal antibody, Clone: F15-42-1-5, Host: Mouse, Species reactivity: Human, Monkey, Isotype: IgG1, kappa, Conjugate: BSA-free, Immunogen: Purified human brain Thy1Unigene 644697, Application: Immunofluorescence, Flow cytometry, Size: 50 uL


Catalog Number: (10075-480)
Supplier: Prosci
Description: Synapsin I plays a key role in synaptic plasticity in the brain (Feng et al.,
2002; Nayak et al., 1996). This effect is due in large part to the ability of the synapsins to regulate
the availability of synaptic vesicles for release. In addition to its role in plasticity, the expression of
synapsin I is a precise indicator of synapse formation (Moore and Bernstein, 1989; Stone et al.,
1994). Thus, Synapsin I immunocytochemistry provides a valuable tool for the study of
synaptogenesis. The role of synapsin in synaptic plasticity and in synaptogensis is regulated by
phosphorylation (Jovanovic et al., 2001; Kao et al., 2002).


Catalog Number: (10474-126)
Supplier: Bioss
Description: This gene is a member of the brain expressed X-linked gene family. The proteins encoded by some of the other members of this family act as transcription elongation factors which allow RNA polymerase II to escape pausing during elongation. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Aug 2011].[SUBCELLULAR LOCATION] [PTM] [SIMILARITY]


Catalog Number: (75788-850)
Supplier: Prosci
Description: The precursor form of Brain-Derived Neurotrophic Factor (pro-BDNF) interacts preferentially with the pan-neurotrophin receptor p75 (p75NTR) and vps10p domain-containing receptor sortilin and induces neuronal apoptosis, whereas mature BDNF selectively binds with high affinity to the TrkB kinase receptor and promotes the survival, growth and differentiation of neurons. As proneurotrophins and mature neurotrophins elicit opposite biological effects, Pro-BDNF cleavage in the neuronal system is regulated in a specific and cell-context dependent manner. Pro-BDNF plays important role in negative regulation of neurotrophic actions in the brain.


Catalog Number: (102552-926)
Supplier: BioVendor
Description: Total 141 AA. MW: 16.0 kDa (calculated). UniProtKB acc.no. O15540. N-Terminal His-tag (10 extra AA)


Catalog Number: (10474-128)
Supplier: Bioss
Description: This gene is a member of the brain expressed X-linked gene family. The proteins encoded by some of the other members of this family act as transcription elongation factors which allow RNA polymerase II to escape pausing during elongation. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Aug 2011].[SUBCELLULAR LOCATION] [PTM] [SIMILARITY]


Catalog Number: (10782-948)
Supplier: Biosensis
Description: Brain derived neurotrophic factor (BDNF) is synthesized as a precursor (proBDNF) which may be released and have physiological functions to cause cell death. It binds neurotrophin receptor p75 and sortilin and may also be important for the development of nervous system. proBDNF is synthesized in neurons and glia (eg., microglia), transported anterogradely and retrogradely and may be released in an activity dependent manner. This antibody is raised in sheep to detect the prodomain of BDNF and not the mature peptide.


Catalog Number: (470182-698)
Supplier: VWR
Description: Helps brain determine body positioning


Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
In order to process your orders without delay, we request that you provide the required business documentation to purchase this product.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • State issued document with your organization's Federal Tax ID Number
  • State issued document with your organization's Resale Tax ID Number
  • City or County issued Business License
  • State Department of Health Services License
  • Any other ID issued by the State that includes the business name and address

* Please note if your account is within the State of California two of these pieces of identification will be required.
VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
657 - 672 of 11,900
no targeter for Bottom