You Searched For: brain4


11,900  results were found

SearchResultCount:"11900"

Sort Results

List View Easy View (new)

Rate These Search Results

Catalog Number: (103223-018)
Supplier: Novus Biologicals
Description: Drebrin 1 Antibody, Polyclonal, Host: Sheep, Species: Human, Isotype: IgG, Immunogen: E. Coli-derived recombinant human Drebrin 1 Asn482-Asp649 (Ser553Pro), Synonyms: D0S117E, DBN1, Developmentally-regulated brain protein, Applications: WB, Size: 100UG


Supplier: Biotium
Description: CD90 Monoclonal antibody, Clone: F15-42-1-5, Host: Mouse, Species reactivity: Human, Monkey, Isotype: IgG1, kappa, Conjugate: CF647, Immunogen: Purified human brain Thy1Unigene 644697, Application: Immunofluorescence, Flow cytometry, Size: 100uL

Catalog Number: (10260-360)
Supplier: Bioss
Description: BSMAP is a 342 amino acid type-I membrane glycoprotein that localizes to organelle membranes and belongs to the TMEM59 family. Expressed at high levels in brain tissue, BSMAP is thought to play a role in brain function and central nervous system activity. The gene encoding BSMAP maps to human chromosome 19, which consists of over 63 million bases, houses approximately 1,400 genes and is recognized for having the greatest gene density of the human chromosomes. It is the genetic home for a number of immunoglobulin (Ig) superfamily members, including the killer cell and leukocyte Ig-like receptors, a number of ICAMs, the CEACAM and PSG family and Fc receptors (FcRs).


Catalog Number: (103231-112)
Supplier: Novus Biologicals
Description: EOMES, Polyclonal Antibody, Host: Sheep, Species reactivity: Human, Isotype: IgG, Immunogen: E. Coli-derived recombinant human EOMES, Synonyms: T-box brain2, TBR2, TBR-2, TBR2eomesodermin homolog, T-brain-2, Application: WB, Immunocytochemistry, Size: 100ug


Supplier: Biotium
Description: CD90 Monoclonal antibody, Clone: F15-42-1-5, Host: Mouse, Species reactivity: Human, Monkey, Isotype: IgG1, kappa, Conjugate: CF594, Immunogen: Purified human brain Thy1Unigene 644697, Application: Immunofluorescence, Flow cytometry, Size: 100uL

Supplier: Biotium
Description: CD90 Monoclonal antibody, Clone: F15-42-1-5, Host: Mouse, Species reactivity: Human, Monkey, Isotype: IgG1, kappa, Conjugate: CF488A, Immunogen: Purified human brain Thy1Unigene 644697, Application: Immunofluorescence, Flow cytometry, Size: 100uL

Supplier: Biotium
Description: CD90 Monoclonal antibody, Clone: F15-42-1-5, Host: Mouse, Species reactivity: Human, Monkey, Isotype: IgG1, kappa, Conjugate: CF405S, Immunogen: Purified human brain Thy1Unigene 644697, Application: Immunofluorescence, Flow cytometry, Size: 100uL

Catalog Number: (75931-116)
Supplier: Rockland Immunochemical
Description: POU3F2, also commonly known as brain-2, is a member of a family of POU domain genes expressed in mouse brain and is thought to be involved in the development of the neocortex and establishment of neural cell lineage. Recent studies suggest that POU3F2 may be involved with the development of neurodegenerative diseases as well as tumor development and proliferation. Along with the neural-lineage-specific transcription factors ASCL1 and MYT1L, POU3F2 can convert fibroblasts to functional neurons in vitro, a form of artificial stem cells termed induced neuronal (iN) cells, suggesting that these cells may be useful in the treatment of neurodegenerative diseases.


Supplier: Anaspec Inc
Description: This is one of the predominant amyloid peptide structures deposited in human brain of Alzheimer’s disease and Down’s syndrome patients.Sequence: Pyr-FRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Molecular Weight: 4309.9 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Supplier: BERTIN CORP
Description: The CKMix50-R and CKMix50 Tissue Grinding Kits are designed for hard tissue grinding and homogenizing

Catalog Number: (103007-484)
Supplier: Anaspec Inc
Description: Dyrktide is designed as the optimal substrate sequence efficiently phosphorylated by DYRK1A, which is a dual-specificity protein kinase that is thought to be involved in brain development.
Sequence:RRRFRPASPLRGPPK
MW:1791.2 Da
% peak area by HPLC:95
Storage condition:-20° C


Catalog Number: (10260-358)
Supplier: Bioss
Description: BSMAP is a 342 amino acid type-I membrane glycoprotein that localizes to organelle membranes and belongs to the TMEM59 family. Expressed at high levels in brain tissue, BSMAP is thought to play a role in brain function and central nervous system activity. The gene encoding BSMAP maps to human chromosome 19, which consists of over 63 million bases, houses approximately 1,400 genes and is recognized for having the greatest gene density of the human chromosomes. It is the genetic home for a number of immunoglobulin (Ig) superfamily members, including the killer cell and leukocyte Ig-like receptors, a number of ICAMs, the CEACAM and PSG family and Fc receptors (FcRs).


Catalog Number: (99990-830)
Supplier: Diagnostic Biosystems
Description: Clone number GA5, This antibody reacts with the 52 kD intermediate filament protein GFAP in brain and spinal cord. It labels some astrocytes and some CNS ependymal cells but not oligodendrocytes or neurons. This antibody does not react with other intermediate filament proteins.


Supplier: Anaspec Inc
Description: Aß (1-40) together with Aß (1-42) are two major C-terminal variants of the Aß protein constituting the majority of Aßs. These undergo post-secretory aggregation and deposition in the Alzheimer’s disease brain.
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Molecular Weight: 4329.9 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Catalog Number: (10474-114)
Supplier: Bioss
Description: This gene is a member of the brain expressed X-linked gene family. The proteins encoded by some of the other members of this family act as transcription elongation factors which allow RNA polymerase II to escape pausing during elongation. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Aug 2011].[SUBCELLULAR LOCATION] [PTM] [SIMILARITY]


Catalog Number: (10075-702)
Supplier: Prosci
Description: Synapsin I plays a key role in synaptic plasticity in brain. This effect is due in large part to the ability of the synapsins to regulate the availability of synaptic vesicles for release. In addition to its role in plasticity, the expression of synapsin I is a precise indicator of synapse formation. Thus synapsin I immunocytochemistry provides a valuable tool for the study of synaptogenesis. The role of synapsin in synaptic plasticity and in synaptogensis is regulated by phosphorylation.


Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
In order to process your orders without delay, we request that you provide the required business documentation to purchase this product.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • State issued document with your organization's Federal Tax ID Number
  • State issued document with your organization's Resale Tax ID Number
  • City or County issued Business License
  • State Department of Health Services License
  • Any other ID issued by the State that includes the business name and address

* Please note if your account is within the State of California two of these pieces of identification will be required.
VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
641 - 656 of 11,900
no targeter for Bottom