Print…

You Searched For: Molecular+Bioproducts+Inc.


377,326  results were found

Refine Results Sort by
SearchResultCount:"377326"

Sort Results

List View Easy View (new)

Rate These Search Results

Image Unavailable-103015-346

Human recombinant S100A14 (from E. coli)

Supplier: ACROBIOSYSTEMS
Description: S100A14 Protein, Host: E.coli, Species Reactivity: Human, Purity: >92% by SDS-PAGE, Molecular Characterization: fused with a polyhistidine tag at the C-terminus, calculated MW of 12.5 kDa, Endotoxin: < 1.0 EU per ug, Synonym: S100A14,S114,S100A15, Storage: 4 deg C, Size: 100ug

Image Unavailable-103015-252

Human Recombinant ROR1 (from HEK293 Cells)

Supplier: ACROBIOSYSTEMS
Description: ROR1 (39-151, Ig-like domain) Protein, Host: HEK293, Species Reactivity: Human, Purity: >95% by SDS-PAGE, Molecular Characterization: fused with a polyhistidine tag at the C-terminus, MW of 13.4 kDa, Synonym: ROR1,NTRKR1, Storage: 4 deg C, Size: 50ug

Image Unavailable-103012-542

Cynomolgus monkey Recombinant CD3 delta (from HEK293 cells)

Supplier: ACROBIOSYSTEMS
Description: Cynomolgus CD3 delta Protein, Host: HEK293 cells, Species Reactivity: Cynomolgus, purity: >90% SDS-PAGE, Molecular Characterization: fused with a polyhistidine tag at the C-terminus, MW of 14.3 kDa, Synonym: CD3D, CD3-DELTA, T3D, Storage: 4 Degree C, size: 1mg

Image Unavailable-103015-150

Avitag™ Human Recombinant PCSK9 (from HEK293 Cells), Biotin, Avi Tag (Avitag™)

Supplier: ACROBIOSYSTEMS
Description: Biotinylated PCSK9 (D374Y), Avitag*, Host: HEK293, Species Reactivity: Human, Purity: >95% by SDS-PAGE, Molecular Characterization: carries an Avitag*at C-terminus, MW of 73.7 kDa, Synonym: PCSK9,FH3,HCHOLA3,LDLCQ1,NARC1,PC9, Storage: 4-8 deg C, Size: 200ug

Image Unavailable-102996-882

PKC (Protein Kinase C) Substrate

Catalog Number: (102996-882)
Supplier: Anaspec Inc
Description: The peptide sequence, ERMRPRKRQGSVRRRV (cat# 27183-1), corresponds to pseudosubstrate region of the ε-isotype of protein kinase C (PKCε) with an alanine to serine substitution. PKCε exhibits an apparent specificity for the native peptide (Km = 68 µM).
Sequence:ERMRPRKRQGSVRRRV
MW:2067.5 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103007-244

HIV TAT-NSF700scr Peptide

Catalog Number: (103007-244)
Supplier: Anaspec Inc
Description: This scrambled human immunodeficiency virus (HIV) transactivator of transcription (TAT) N-ethylmaleimide-sensitive factor (NSF) 700scr peptide is used as a control peptide to TAT-NSF700 peptide. It does not inhibit the disassembly activity of NSF in contrast to the TAT-NSF700 which plays a critical role in regulating exocytosis.
Sequence: YGRKKRRQRRRGGGIPPVYFSRLDLNLVVLLLAQL
MW: 4109.9 Da
% Peak area by HPLC: 95
Storage condition: -20°C
Image Unavailable-102770-940

Galactose Oxidase (from Fusarium graminearum)

Supplier: Innovative Research Inc
Description: Animal free galactose oxidase purified lyophilized has been purified from Fusarium graminearum (previously misclassified as Dactylium dendroides). This is a lyophilized powder using sodium phosphate and sucrose as stabilizers.

Image Unavailable-103015-126

Mouse Recombinant PCSK9 (from HEK293 Cells)

Supplier: ACROBIOSYSTEMS
Description: PCSK9 Protein, Host: HEK293, Species Reactivity: Mouse, Purity: >97% by SDS-PAGE, Molecular Characterization: fused with a polyhistidine tag at the C-terminus, calculated MW of 72 kDa, Synonym: PCSK9,FH3,HCHOLA3,LDLCQ1,NARC1,PC9, Storage: 4 degree Celcius, Size: 100ug

Image Unavailable-103012-498

Human Recombinant CD9 (from HEK293 Cells)

Supplier: ACROBIOSYSTEMS
Description: Human CD9 Protein, Host: HEK293 cells, Species Reactivity: Human, purity: >95% SDS-PAGE, Molecular Characterization: fused with a polyhistidine tag at the C-terminus, MW of 10.5 kDa, Synonym: CD9,MIC3,TSPAN29,GIG2,MRP1,BTCC1, Storage: 4 Degree C, size: 20ug

Image Unavailable-102996-096

Pig Big Endothelin 1 (1-39)

Catalog Number: (102996-096)
Supplier: Anaspec Inc
Description: This is a 38 residue inactive big endothelin-1 intermediate that gives rise to a shorter active peptide produced in vascular endothelial cells.
Sequence:CSCSSLMDKECVYFCHLDIIWVNTPEHIVPYGLGSPSRS (Disulfide bridge: 1-15 and 3-11)
MW:4384.1 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C
Image Unavailable-103008-232

Interphotoreceptor Retinoid Binding Protein Fragment Peptide

Catalog Number: (103008-232)
Supplier: Anaspec Inc
Description: R16 is an IRBP (Interphotoreceptor retinoid binding protein) derived peptide. Photoreceptor cell protein is capable of inducing an experimental autoimmune uveitis (EAU) in susceptible animal strains.
Sequence:ADGSSWEGVGVVPDV
MW:1473.6 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103014-152

Human Recombinant Fc gamma RIIA / CD32a (from HEK293 cells)

Supplier: ACROBIOSYSTEMS
Description: Fc gamma RIIA/CD32a (R131) Protein, Host: HEK293 cells, Species Reactivity: Human, Purity: >95% (SDS-PAGE), Molecular Characterization: His Tag fused with polyhistidine tag at C-terminus, MW 21.2KDa, Synonyms: CD32a,FCGR2A,CD32, Size: 1mg

Image Unavailable-103013-838

Human Recombinant TRAIL R2 (from HEK293 Cells)

Supplier: ACROBIOSYSTEMS
Description: TRAIL R2/DR5/TNFRSF10B Protein, Host: HEK293 cells, Species Reactivity: Human, Purity: >95% (SDS-PAGE), Molecular Characterization: His Tag fused with polyhistidine tag at C-terminus, MW 15.1KDa, Synonyms: TNFRSF10B,TRAILR2,TRAIL-R2, Size: 100ug

Image Unavailable-103012-326

Human Recombinant Carbonic Anhydrase IX (from HEK293 cells)

Supplier: ACROBIOSYSTEMS
Description: Human Carbonic Anhydrase IX/CA9 (38-414) Protein, Host: HEK293 cells, Species Reactivity: Human, purity: >95% SDS-PAGE, Molecular Characterization: fused with a polyhistidine tag at the C-terminus, MW of 41.2 kDa, Synonym: CAIX,CA9, size: 50ug

Image Unavailable-103012-890

Human Recombinant EphB4 (from HEK293 cells)

Supplier: ACROBIOSYSTEMS
Description: EphB4 Protein, Biotinylated, ultra sensitivity (primary amine labeling), Host: HEK293 Cells, Species: Human, Purity: >97% SDS-PAGE, Molecular Characterization: protein carries a polyhistidine tag at C-terminus, MW 57.8 kDa, Synonym: EphB4, HTK, MYK1, TYRO11, Size: 1mg

Image Unavailable-103014-880

Human Recombinant LDL R (from HEK293 cells)

Supplier: ACROBIOSYSTEMS
Description: LDL R Protein, Host: HEK293 Cells, Species Reactivity: Human, purity: >90%, Molecular Characterization: polyhistidine tag at the C-terminus, MW of 86 kDa, Endotoxin: Less than 1.0 EU per ug, Synonym: LDLR,FH,FHC,LDLCQ2, Storage: 4 deg C, Size: 1MG

Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
In order to process your orders without delay, we request that you provide the required business documentation to purchase this product.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • State issued document with your organization's Federal Tax ID Number
  • State issued document with your organization's Resale Tax ID Number
  • City or County issued Business License
  • State Department of Health Services License
  • Any other ID issued by the State that includes the business name and address

* Please note if your account is within the State of California two of these pieces of identification will be required.
VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
1,409 - 1,424 of 377,326
no targeter for Bottom