Print…

You Searched For: Molecular+Bioproducts+Inc.


377,217  results were found

Refine Results Sort by
SearchResultCount:"377217"

Sort Results

List View Easy View (new)

Rate These Search Results

Image Unavailable-103007-714

3 x Hemagglutinin (HA) Tag

Catalog Number: (103007-714)
Supplier: Anaspec Inc
Description: This tag peptide may be used to detect proteins and peptides, and to facilitate functional analysis of proteins of interest.
Sequence:MEYPYDVPDYAAEYPYDVPDYAAEYPYDVPDYAAKLE
MW:4372.7 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103012-212

Human Recombinant Angiopoietin-like 4 (from HEK293 cells)

Supplier: ACROBIOSYSTEMS
Description: Human Angiopoietin-like 4/ANGPTL4 (166-406) Protein, Host: HEK293 cells, Species Reactivity: Human, purity: >95% SDS-PAGE, Molecular Characterization: fused with a polyhistidine tag at the N-terminus, MW of 27.9 kDa, size: 100ug

Image Unavailable-103014-406

Human Recombinant Growth Hormone R (from HEK293 cells), Biotin

Supplier: ACROBIOSYSTEMS
Description: Biotinylated Growth Hormone R, ultra sensitivity (primary amine labeling), Host: HEK293 Cells, Species Reactivity: Human, purity: >95%, Molecular Characterization: MW of 28.5 kDa, Synonym: GHR,GHBP,GH receptor, Storage: 4-8 deg C, Size: 50UG

Image Unavailable-103012-190

Mouse Recombinant ADAM17 (from HEK293 cells)

Supplier: ACROBIOSYSTEMS
Description: Mouse ADAM17/TACE/CD156b Protein, Host: HEK293 cells, Species Reactivity: mouse, purity: >90% SDS-PAGE, Molecular Characterization: fused with a polyhistidine tag at the C-terminus, MW of 63.4 kDa, Synonym: 4-1BB Ligand, TNFSF9, size: 500ug

Image Unavailable-103012-634

Human Recombinant Contactin-2 (from HEK293 Cells)

Supplier: ACROBIOSYSTEMS
Description: Human Contactin-2/Tag1/CNTN2 Protein, Host: HEK293 cells, Species Reactivity: Human, purity: >95% SDS-PAGE, Molecular Characterization: fused with a polyhistidine tag at the C-terminus, MW of 109 kDa, Synonym: CNTN2,AXT,DKFZp781D102, size: 1mg

Image Unavailable-103015-500

Human Recombinant Transferrin R (from HEK293 Cells), Biotin

Supplier: ACROBIOSYSTEMS
Description: Biotinylated Transferrin R/CD71, ultra sensitivity (primary amine labeling), Host: HEK293 cells, Species Reactivity: Human, Purity: >92%(SDS-PAGE), Molecular Characterization: Carries polyhistidine tag at N-terminus, MW 76KDa, Synonym: CD71, Size: 25ug

Image Unavailable-103013-768

Human Recombinant TIMP-2 (from HEK293 Cells)

Supplier: ACROBIOSYSTEMS
Description: TIMP-2 Protein, Host: HEK293 cells, Species Reactivity: Human, Purity: >98% (SDS-PAGE), Molecular Characterization: His Tag is fused with a polyhistidine tag at the C-terminus, with calculated MW of of 22.6 KDa, Synonyms: CSC-21K,TIMP2, Storage: 4 degree C, Size: 1mg

Image Unavailable-103007-628

CDK7/9 tide

Catalog Number: (103007-628)
Supplier: Anaspec Inc
Description: This is a peptide substrate for CDK7 or CDK9 (cyclin dependent protein kinase), the catalytic subunit of the CDK.
Sequence:YSPTSPSYSPTSPSYSPTSPSKKKK
MW:2690 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-102996-428

Kallikrein Substrate, AMC (7-amino-4-methylcoumarin)

Catalog Number: (102996-428)
Supplier: Anaspec Inc
Description: This is a fluorescent kallikrein substrate, Abs/Em=353/442 nm.
Sequence:Z-FR-AMC
MW:612.6 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-102999-788

Human Beta-Amyloid (1-38)

Supplier: Anaspec Inc
Description: Beta-amyloid is the main component of amyloid deposits in the AD brain. Beta-amyloid peptides have a heterogeneous C-terminus with the majority composed ofAβ1-40, while a minor product is Aβ 1-42. Additional minor Aβ peptides are also normally produced, such as Beta-amyloid 1-34, 1-37, 1-38 and 1-39, and few reports have quantified the levels of these peptides in the brain.
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGG
Molecular Weight: 4131.6 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Image Unavailable-103012-528

Human Recombinant CD19 (from HEK293 cells), Biotin, Fc Tag

Supplier: ACROBIOSYSTEMS
Description: Biotinylated Human CD19, Fc Tag, ultra sensitivity, Host: HEK293 cells, Species Reactivity: Human, purity: >95% SDS-PAGE, Molecular Characterization: fused with a human IgG1 Fc tag at the C-terminus, MW of 56.3 kDa, size: 200ug

Image Unavailable-103012-472

Human Recombinant CD38 (from HEK293 Cells)

Supplier: ACROBIOSYSTEMS
Description: Human CD38 Protein, Host: HEK293 cells, Species Reactivity: Human, purity: >90% SDS-PAGE, Molecular Characterization: fused with a polyhistidine tag at the C-terminus, MW of 30.7 kDa, Synonym: CD38,T10,cADPr hydrolase 1, Storage: 4 Degree C, size: 1mg

Image Unavailable-103013-920

Human Recombinant VEGF121 (from HEK293 Cells)

Catalog Number: (103013-920)
Supplier: ACROBIOSYSTEMS
Description: ActiveMax* Recombinant VEGF121 (HPLC-verified), Host: HEK293 cells, Species Reactivity: Human, Purity: >95%(SDS-PAGE), Molecular Characterization: Tag Free, with calculated MW of of 14 KDa, Synonyms: RP1-261G23.1,MGC70609,MVCD1,VEGFA, Size: 50ug
Image Unavailable-103014-666

Human Recombinant IL-7 (from HEK293 Cells)

Catalog Number: (103014-666)
Supplier: ACROBIOSYSTEMS
Description: ActiveMax* Recombinant IL-7, Host: HEK293 Cells, Species Reactivity: Human, purity: >95%, Molecular Characterization: contains no tag, MW of 17 kDa, Endotoxin: Less than 1.0 EU per ug, Synonym: IL7,Interleukin-7, Storage: 4 deg C, Size: 50UG
Image Unavailable-10772-202

Human Recombinant Prokineticin-2 (from E. coli)

Supplier: PeproTech, Inc.
Description: Prokineticin-2 (PK2) is a cysteine-rich secreted protein that is expressed in the testis and, in lower levels, in the small intestine. PK2 regulates various biological functions, including gastrointestinal motility, angiogenesis and circadian rhythms. It is closely related to EG-VEGF (Prokineticin-1), and binds to two orphan B-protein-coupled receptors termed PK-R1 and PK-R2. Recombinant Human Prokineticin-2 is an 8.8 kDa protein consisting of 81 amino acid residues, including ten cysteine residues that can potentially form five pairs of intra-molecular disulfide bonds.

Image Unavailable-103012-288

Human Recombinant HABP1 (from E. coli)

Supplier: ACROBIOSYSTEMS
Description: Human HABP1/C1QBP Protein, Host: E.coli cells, Species Reactivity: human, purity: >95% SDS-PAGE, Molecular Characterization: fused with a polyhistidine tag at the C-terminus, MW of 24.6 kDa, Synonym: C1QBP, HABP1, SF2P32, p33, Storage: 4 Degree C, size: 1mg

Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
In order to process your orders without delay, we request that you provide the required business documentation to purchase this product.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • State issued document with your organization's Federal Tax ID Number
  • State issued document with your organization's Resale Tax ID Number
  • City or County issued Business License
  • State Department of Health Services License
  • Any other ID issued by the State that includes the business name and address

* Please note if your account is within the State of California two of these pieces of identification will be required.
VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
897 - 912 of 377,217
no targeter for Bottom