You Searched For: Molecular+Bioproducts+Inc.


323,914  results were found

SearchResultCount:"323914"

Sort Results

List View Easy View (new)

Rate These Search Results

Supplier: AAT BIOQUEST INC
Description: AAT Bioquest is committed to designing our products to be environment-friendly.

Small Business Enterprise Minority or Woman-Owned Business Enterprise

Catalog Number: (103006-672)
Supplier: Anaspec Inc
Description: This is a scrambled sequence of LL-37 used in control experiments.
Sequence: GLKLRFEFSKIKGEFLKTPEVRFRDIKLKDNRISVQR
MW: 4493.3 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C


Catalog Number: (103007-790)
Supplier: Anaspec Inc
Description: This peptide is a substrate for p70 ribosomal S6 kinase.
Sequence:KKRNRTLTV
MW:1115.4 Da
% peak area by HPLC:95
Storage condition:-20° C


Supplier: MICROBIOLOGICS, INC.
Description: Everything you need to grow reference cultures for QC testing is included in this one handy device.

Catalog Number: (103011-056)
Supplier: Anaspec Inc
Description: DABCYL Plus™ C2 maleimide is an excellent thiol-reactive building block for developing DABCYL Plus™-based FRET probes.


Catalog Number: (103008-452)
Supplier: Anaspec Inc
Description: This peptide is amino acids 3 to 16 fragment of beta-Amyloid (Aß) with an N-terminal deletion that alters the coordination environment for the Cu2+ binding site. Oxidation targets for Aß (1-16) are the histidine residues coordinated to the meta.
Sequence: EFRHDSGYEVHHQK
Molecular Weight: 1768.9 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C


Catalog Number: (103010-932)
Supplier: Anaspec Inc
Description: Spectra of HiLyte™ Fluor 555 conjugates are slightly red-shifted compared to those of Cy3 dyes, resulting in an optimal match to filters designed for Cy3 dyes.


Catalog Number: (103010-224)
Supplier: Anaspec Inc
Description: QXL® 490 dyes are the optimized quenchers for EDANS, AMCA and most coumarin fluorophores.


Supplier: Thermo Fisher Scientific Chemicals Inc.
Description: Used for nucleic acid extraction and purification.

Supplier: Anaspec Inc
Description: Aß (1-40) together with Aß (1-42) are two major C-terminal variants of the Aß protein constituting the majority of Aßs. These undergo post-secretory aggregation and deposition in the Alzheimer’s disease brain.
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Molecular Weight: 4329.9 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Supplier: AAT BIOQUEST INC
Description: AAT Bioquest is committed to designing our products to be environment-friendly.

Small Business Enterprise Minority or Woman-Owned Business Enterprise

Catalog Number: (76484-658)
Supplier: AAT BIOQUEST INC
Description: Protein quantification is an essential task in protein purification, electrophoresis, cell biology, molecular biology and other research applications.

Small Business Enterprise Minority or Woman-Owned Business Enterprise


Supplier: Polysciences Inc
Description: Molecular Weight: 10,000 (bPEI 10000)
Density: 1.029-1.038
Viscosity: 40,000 - 150,000 cps
Soluble In: water, lower alcohols, glycols, and THF
Resin Content (wt%): 99%
Appearance: clear light yellow viscous liquid

SDS

Catalog Number: (76484-588)
Supplier: AAT BIOQUEST INC
Description: Protein quantification is an essential task in protein purification, electrophoresis, cell biology, molecular biology and other research applications.

Small Business Enterprise Minority or Woman-Owned Business Enterprise


Supplier: MilliporeSigma
Description: DNase-, RNase, protease-, and phosphatase-free.
Supplier: Biosynth International Inc
Description: 5-Aminolevulinic acid hydrochloride is a δ-amino acid and be used as bronsted acid.

SDS

Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
In order to process your orders without delay, we request that you provide the required business documentation to purchase this product.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • State issued document with your organization's Federal Tax ID Number
  • State issued document with your organization's Resale Tax ID Number
  • City or County issued Business License
  • State Department of Health Services License
  • Any other ID issued by the State that includes the business name and address

* Please note if your account is within the State of California two of these pieces of identification will be required.
VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
289 - 304 of 323,914
no targeter for Bottom