Print…

You Searched For: Molecular+Bioproducts+Inc.


613,118  results were found

Refine Results Sort by

Sort Results

List View Easy View (new)
SearchResultCount:"613118"

Rate These Search Results

Image Unavailable-103790-182

Recom Cd155 > 95% Mouse 61.8 Kda 1Mg

Description: CD155 Recombinant, Purity: > 95%, Species Reactivity: Mouse, Source: HEK293, Molecular Weight: 61.8 kDa, Tag: IgG2a Fc Tag, Endotoxin: Less than 1.0 EU per ug by the LAL method, Synonyms: PVR, FLJ25946, PVS, TAGE4, HVED, NECL5, Size: 1mg
Catalog Number: 103790-182
Supplier: ACROBIOSYSTEMS
Product Image-470175-932

LAMBDA DNA/ECORI/HINDIII DIG-FREEZE UPON

Catalog Number: 470175-932
Supplier: VWR
Product Image-470175-928

LAMBDA DNA/ECOR I DIG-FREEZE UPON RECPT

Catalog Number: 470175-928
Supplier: VWR
Image Unavailable-103005-902

GRPRTSSFAEG 5 mg

Description: GRPRTSSFAEG, Molecular Weight: 1164.2, Purity: >95%, Appearance: Lyophilized white powder, Storage: -20 degree Celcius, Size: 5 mg
Catalog Number: 103005-902
Supplier: Anaspec Inc
Image Unavailable-102996-562

Peptide YY (3-36) 0.5 mg

Description: Peptide YY (3-36), human, Purity: HPLC >/= to 95%, Molecular Weight: 4049.5, Sequence: IKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2, Appearance: Lyophilized white powder, is a Y2R agonist, is released from the gastrointestinal tract postprandially, Size: 0.5 mg
Catalog Number: 102996-562
Supplier: Anaspec Inc
Image Unavailable-103007-830

Bcl-2 Binding Peptide Bad BH3 Peptide

Description: Bcl-2 Binding Peptide, Bad BH3 Peptide, Sequence: LWAAQRYGRELRRMSDEFEGSFKGL, Purity: By HPLC >/= 95%,
This is a bcl-2 binding peptide derived from the BH3 domain (a death domain) of Bad, amino acid residues 140 to 165, Molecular Weight: 3003.4, Size: 1 mg
Catalog Number: 103007-830
Supplier: Anaspec Inc
Product Image-76446-866

VWR* Tube, Pcr, 12-Strip with Cap, assorted colors, Ultra-thin walls ensure efficient thermal transfer/maximum yield, yet are strong enough to prevent crushing, For use in medical, pharmaceutical/food industry, and molecular biology, Clear tubes provide high clarity for visualizing contents

Description: VWR* Tube, Pcr, 12-Strip with Cap, assorted colors, Ultra-thin walls ensure efficient thermal transfer/maximum yield, yet are strong enough to prevent crushing, For use in medical, pharmaceutical/food industry, and molecular biology, Clear tubes provide high clarity for visualizing contents
Catalog Number: 76446-866
Supplier: VWR International
Image Unavailable-10770-762

Human Recombinant BD1 (from E. coli)

Description: Human Recombinant BD1 (from <i>E. coli</i>)
Catalog Number: 10770-762
Supplier: PeproTech, Inc.
Image Unavailable-76303-966

Mouse Recombinant VCAM-1 (from CHO cells)

Description: Mouse Recombinant VCAM-1 (from CHO cells)
Catalog Number: 76303-966
Supplier: PeproTech, Inc.
Image Unavailable-10770-766

Human Recombinant BD1 (from E. coli)

Description: Human Recombinant BD1 (from <i>E. coli</i>)
Catalog Number: 10770-766
Supplier: PeproTech, Inc.
Image Unavailable-103007-650

[Lys(Me2)9]-Histone H3 (1-21)-K(Biotin) H3K9(Me2) 1 mg

Description: [Lys(Me2)9]-Histone H3 (1-21)-K(Biotin) H3K9(Me2), biotin-labeled, Sequence: ARTKQTAR-K(Me2)-STGGKAPRKQLA-K(Biotin), Purity: By HPLC >/= 95%, residues 1 to 21. Lysine 9 is di-methylated, Molecular Weight: 2637.1, Size: 1 mg
Catalog Number: 103007-650
Supplier: Anaspec Inc
Image Unavailable-103006-352

Cyclo ( - GRGDSP) N to C cyclized 5 mg

Description: Cyclo ( - GRGDSP) N to C cyclized, Purity: HPLC greater than or equal to 95%, Sequence (Three-Letter Code): Cyclo( - Gly - Arg - Gly - Asp - Ser - Pro), Molecular Weight: 569.6, Appearance: Lyophilized white powder, Storage: -20 degree C, Size: 5 mg
Catalog Number: 103006-352
Supplier: Anaspec Inc
Image Unavailable-103006-350

Cyclo ( - GRGDSP) N to C cyclized 1 mg

Description: Cyclo ( - GRGDSP) N to C cyclized, Purity: HPLC greater than or equal to 95%, Sequence (Three-Letter Code): Cyclo( - Gly - Arg - Gly - Asp - Ser - Pro), Molecular Weight: 569.6, Appearance: Lyophilized white powder, Storage: -20 degree C, Size: 1 mg
Catalog Number: 103006-350
Supplier: Anaspec Inc
Image Unavailable-10779-506

Recombinant Human PECAM-1

Description: Recombinant Human PECAM-1, 572 AA glycoprotein comprising the extracellular domain of PECAM-1, 64.3kDa, transmembrane glycoprotein, Ig-related superfamily, Source: HEK293 cells, >97%, Synonym: Platelet endothelial cell adhesion molecule, CD31 antigen, EndoCAM, 250UG
Catalog Number: 10779-506
Supplier: PeproTech, Inc.
Image Unavailable-10779-500

Recombinant Human PECAM-1

Description: Recombinant Human PECAM-1, 572 amino acid glycoprotein comprising the extracellular domain of PECAM-1, 64.3kDa, transmembrane glycoprotein, Ig-related superfamily, Source: HEK293 cells, >97%, Synonym: Platelet endothelial cell adhesion molecule, CD31 antigen, EndoCAM, 10UG
Catalog Number: 10779-500
Supplier: PeproTech, Inc.
Image Unavailable-10779-510

Recombinant Human PECAM-1

Description: Recombinant Human PECAM-1, 572 amino acid glycoprotein comprising the extracellular domain of PECAM-1, 64.3kDa, transmembrane glycoprotein, Ig-related superfamily, Source: HEK293 cells, >97%, Synonyms: Platelet endothelial cell adhesion molecule, CD31 antigen, EndoCAM, 1MG
Catalog Number: 10779-510
Supplier: PeproTech, Inc.
2,641 - 2,656 of 613,118