You Searched For: Bioclone Inc.

Supplier: AVANTOR PERFORMANCE MATERIAL LLC

Description: Powder. For liquid chromatography and molecular biology applications. Lot analysis on label.

Certificates

Catalog Number: (102996-346)

Supplier: Anaspec Inc

Description: The intrastriatal perfusion with the neurotensin(1-13) [NT(1-13)] and its active fragment NT(8-13) on striatopallidal GABA leads to the increased striatal and pallidal GABA release, and this effect is antagonized by intrastriatal perfusion with the NT receptor antagonist. Neurotensin(8-13) is as potent as neurotensin but ineffective in [D-Tyr(11)]neurotensin. In the caudal nucleus accumbens, neurotensin(8-13) and neurotensin appears more potent than [D-Tyr(11)]neurotensin. In contrast, in the rostral nucleus accumbens, neurotensin(8-13) is less potent than [D-Tyr(11)]neurotensin and neurotensin.
Sequence:RRPYIL
MW:817 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Sale

Catalog Number: (102999-778)

Supplier: Anaspec Inc

Description: This is Oxytocin (OT) N-terminally labeled with Biotin. OT is a 9-amino acid peptide that is synthesized primarily in the hypothalamic neurons, specifically the magnocellular oxytocin neurons in the supraoptic and paraventricular nuclei and is secreted by the posterior pituitary gland. It is also secreted from other tissues, such as the ovaries and testes. Circulating OT is important during parturition and lactation. In the pregnant uterus, oxytocin and the oxytocin receptor play a major part for uterine contractility and the induction of labor. OT is also involved in complex social behaviors such as affiliation, sexual behavior, social recognition, stress buffering, aggression, and trust.
Sequence: Biotin-CYIQNCPLG-NH2 (Disulfide bridge: 1-6)
MW: 1234.5 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Sale

Catalog Number: (PAG1731)

Supplier: Promega Corporation

Description: Created by digesting lambda DNA to completion with EcoRI and HindIII to generate 13 fragments of 125-21,226bp.

Certificates Sale

Supplier: Anaspec Inc

Description: Myelin oligodendrocyte glycoprotein (MOG) is a member of the immunoglobulin superfamily and is expressed exclusively in the central nervous system. It is a glycoprotein observed to be important in the myelination of nerves. It is a central molecule actively studied for its role in Multiple Sclerosis. MOG (35-55) is able to induce autoantibody production and relapsing-remitting neurological disease causing extensive plaque-like demyelination. Autoantibody response to MOG (35-55) has been observed in multiple sclerosis (MS) patients and MOG (35-55)-induced experimental autoimmune encephalomyelitis (EAE) C57/BL6 mice and Lewis rats.
Sequence: MEVGWYRSPFSRVVHLYRNGK
MW: 2582 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C

Catalog Number: (103008-632)

Supplier: Anaspec Inc

Description: This peptide is histone H4 amino acid residues 1 to 21. It is asymmetrically dimethylated at Arg3 with both methyl groups added to one nitrogen of the guanidinium group, and also contains a C-terminal GG linker, followed by a biotinylated Lys. Methylation of histone H4 at Arg3 is an important step in transcriptional activation, and allows for subsequent acetylation of H4 tails by p300. Provided at >95% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.
Sequence:Ac-SG-R(Me2a)-GKGGKGLGKGGAKRHRKV-GGK(Biotin)
MW:2630.14 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Catalog Number: (103007-792)

Supplier: Anaspec Inc

Description: Genetic transformation in Streptococcus pneumoniae, Streptococcus mitis and Streptococcus oralis is regulated by secreted peptide pheromones named the competence-stimulating peptide (CSP). Different strains and species of these bacteria produce CSP with different primary sequence. They are termed pheromones CSP-1 (EMRLSKFFRDFILQRKK), CSP-2 (EMRISRIILDFLFLRKK), CSP-153 (DKRLPYFFKHLFSNRTK), CSP-612 (ESRLSRLLRDFIFQIKQ), CSP-676 (ERRIPDVIRSLLFQKRK), and CSP-12261 (EIRQTHNIFFNFFKRR).
Sequence:EMRISRIILDFLFLRKK
MW:2178.7 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Catalog Number: (103007-330)

Supplier: Anaspec Inc

Description: This peptide is amino acids 311 to 325 fragment of the influenza virus nucleoprotein (NP). This bona fide MHC class II restricted epitope from influenza virus was used to study the host immunoresponse during the infection. This peptide elicits the strongest gamma interferon (IFN-gamma) production in the intracellular cytokine assays. It does not stimulate CD8 T-cells in mice.
Sequence:QVYSLIRPNENPAHK
MW:1767 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Supplier: Anaspec Inc

Description: This hypophysiotropic peptide was isolated from human hypothalamic-hypophysial tissues. Within this 1 to 29 amino acid GRF fragment, amino acids 13 to 21 are more important than 24 to 29 for high affinity receptor binding. Structure–activity studies show that hpGRF(1–29)-NH2 has full intrinsic activity and potency in vitro as the full length GRF in stimulating growth hormone release. Human GRF (1-29) has a high degree (>93%) homology with procine, bovine and ovine GRF (1-29)-NH2.
Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2
MW: 3357.9 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Supplier: Ward's Science

Description: CAS Number: 7772-98-7
Formula Weight: 158.11
Formula: Na₂S₂O₃
Density (g/mL): 1.667
Boiling Point (°C): >100
Freezing Point (°C): 48
Solubility: Water
Synonyms: Sodium Hyposulfite
Shelf Life (months): 12
Storage: Green

SDS

Catalog Number: (470225-740)

Supplier: Ward's Science

Description: CAS Number: 7631-99-4
Formula Weight: 84.99
Formula: NaNO3
Hazard Info: Oxidizer, Explosive, Toxic
Density (g/mL): 2.261
Freezing Point (°C): 307
Solubility: Water and Alcohol
Synonyms: Nitrate of Soda, Chile Saltpeter
Shelf Life (months): 36
Storage: Yellow

SDS Sale

Catalog Number: (470225-816)

Supplier: Ward's Science

Description: CAS Number: 5970-45-6
Formula Weight: 219.50
Formula: Zn(C₂H₃O₂)₂·2H₂O
Hazard Info: Irritant
Density (g/mL): 1.74
Solubility: Water and Alcohol
Shelf Life (months): 36
Storage: Green

SDS Sale

Catalog Number: (103007-372)

Supplier: Anaspec Inc

Description: This sequence is amino acids 1 to 21 fragment of the histone 4. Histone acetyltransferase (HAT) p300/CBP catalyses the acetylation of this N-terminal tail of free histone H4 at Lys5, 8, 12, 16. Lys8 is thought to be the preferred acetylation site in H4. Determinants of interaction of p300 with histone 4 appear to be fully present on H4-21, the N-terminal region of the protein.
Sequence:SGRGKGGKGLGKGGAKRHRKV
MW:2091.5 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Catalog Number: (103006-116)

Supplier: Anaspec Inc

Description: Des-octanoyl (or Des-acyl) Ghrelin is the unacylated precursor peptide to Ghrelin. Des-octanoyl Ghrelin is converted to Ghrelin by the enzymic addition of an octanyl group. Studies indicate that the amount of Des-octanoyl Ghrelin in the circulation is approximately 20 fold higher than that of Ghrelin. Des-octanoyl Ghrelin is not an agonist of the Ghrelin growth hormone receptor 1a (GHSR1a).
Sequence: GSSFLSPEHQKAQQRKESKKPPAKLQPR
MW: 3188.7 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Sale

Catalog Number: (103006-386)

Supplier: Anaspec Inc

Description: Des-octanoyl (or Des-acyl) Ghrelin, DAG, is the unacylated precursor peptide to Ghrelin. Des-octanoyl Ghrelin is converted to Ghrelin by the enzymic addition of an octanyl group. Studies indicate that the amount of Des-octanoyl Ghrelin in the circulation is approximately 20 fold higher than that of Ghrelin. Des-octanoyl Ghrelin is not an agonist of the Ghrelin growth hormone receptor 1a (GHSR1a).
Sequence: GSSFLSPEHQRVQQRKESKKPPAKLQPR
MW: 3244.7 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Sale

Catalog Number: (103007-528)

Supplier: Anaspec Inc

Description: The Staphylococcus aureus transpeptidase Sortase A (SrtA) anchors virulence and colonization-associated surface proteins to the cell wall. SrtA selectively recognizes a C-terminal LPXTG motif. SrtA readily reacts with its native substrate Abz-LPETG-Dap(DNP)-NH2, cleaving it and catalyzing the formation of an amide bond between the carboxyl group of threonine and the amino group of cell-wall crossbridges. Cleavage of this FRET substrate can be monitored at Ex/Em=320 nm/420 nm.
Sequence:Abz-LPETG-K(Dnp)-NH2
MW:928 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale