Human Growth Hormone Releasing Factor, GRF (1-29), amide

Supplier: Hytest Ltd
Ratings: (No Reviews)

Total Ratings: 0
Avg. Ratings: 0.0 out of 5

AS-22874 AS-22875
102996-318EA 157.85 USD
102996-318 102996-320
Human Growth Hormone Releasing Factor, GRF (1-29), amide
Proteins and Peptides

This hypophysiotropic peptide was isolated from human hypothalamic-hypophysial tissues. Within this 1 to 29 amino acid GRF fragment, amino acids 13 to 21 are more important than 24 to 29 for high affinity receptor binding. Structure–activity studies show that hpGRF(1–29)-NH2 has full intrinsic activity and potency in vitro as the full length GRF in stimulating growth hormone release. Human GRF (1-29) has a high degree (>93%) homology with procine, bovine and ovine GRF (1-29)-NH2.
Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2
MW: 3357.9 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Order Now


Learn more

About VWR

Avantor is a vertically integrated, global supplier of discovery-to-delivery solutions for...

Learn more About VWR