You Searched For: Molecular+Bioproducts+Inc.


249,603  results were found

SearchResultCount:"249603"

Sort Results

List View Easy View (new)

Rate These Search Results

Catalog Number: (AAJ67051-AMI)
Supplier: Thermo Scientific Chemicals
Description: This DNA Molecular Weight Marker is used for rapid and precise sizing of DNA strands.

SDS


Supplier: ACROBIOSYSTEMS
Description: Human IL-7 R alpha&TSLP R Heterodimer Protein, Fc Tag&Fc Tag (MALS verified), Source: expressed from HEK293, Predicted N-terminus: Glu 21 (IL-7 RA) & Gln 23 (TSLP R), Molecular weight: 51.7 kDa (IL-7 RA) and 50.3 kDa (TSLP R), Synonyms: IL7Ra, CD127, TSLP R, CRLF2, IL-XR, ILXR, Size: 1mg

Supplier: Thermo Scientific Chemicals
Description: MDL: MFCD00131613
Catalog Number: (BJ34241-250G)
Supplier: Honeywell Research Chemicals
Description: Hydranal* Molecular sieve 0.3 nm, Drying agent for air and gases for KF titration, Cas: 7761-88-8, Molar mass:  169.87 g/mol, Container Type: Glass bottle, Pore size: 0.3 nm, Size: 250G

Catalog Number: (EM-MX1583A-1)
Supplier: MilliporeSigma
Description: Pellets.

Supplier: Thermo Scientific Chemicals
Description: 1KG
Catalog Number: (103003-398)
Supplier: Anaspec Inc
Description: Galanin, a 29 or 30 (in human) amino acid neuropeptide, is found in the central and peripheral nervous systems and displays several important physiological activities. These actions are mediated through distinct G protein-coupled receptors. It has been involved in food behavior, regulation of sleep and mood, control of blood pression and nociception, among others.
Sequence:GWTLNSAGYLLGPHAVGNHRSFSDKNGLTS
MW:3157.5 Da
% peak area by HPLC:95
Storage condition:-20° C


Catalog Number: (TS19730-0050)
Supplier: THERMO FISHER SCIENTIFIC CHEMICALS
Description: Molecular sieve 13X (1.0 nm, 10 Å) 4 - 8 mesh


Supplier: ACROBIOSYSTEMS
Description: Cynomolgus / Rhesus macaque FcRn / FCGRT&B2M Heterodimer Protein, His Tag (BLI verified), ACROBiosystems

Supplier: MilliporeSigma
Description: Molecular sieve A4 (0.4 nm, 4 Å), beads Reag. Ph. Eur. ~ 2 mm, Supelco®
Supplier: Thermo Scientific Chemicals
Description: Grade: NA, Melting Point C. Boiling Point C: NA. 000-00-0. HYGROSCOPIC
Supplier: Honeywell Research Chemicals
Description: Molecular Sieve Dehydrate, Beads, with indicator for drying solvents, Grade: Analytical, CAS Number: 50-21-5, Molar mass: 90.08 g/mol, Container Type: poly bottle, Appearance: Slightly Brown To Light Brown And Blue, Size: 1KG

SDS

Supplier: ACROBIOSYSTEMS
Description: Cynomolgus CD3E&CD3G Heterodimer Protein, Fc Tag&Fc Tag (MALS verified), Source: expressed from human 293 cells (HEK293), Predicted N-terminus: Gln 22 (CD3E) & Gln 23 (CD3G), Molecular weight: 40.6 kDa (CD3E) and 40.4 kDa (CD3G), Synonyms: CD3 epsilon & CD3 gamma, CD3E & CD3G, Size: 1mg

Supplier: ACROBIOSYSTEMS
Description: Mouse Integrin alpha 10 beta 1 (ITGA10&ITGB1) Heterodimer Protein, His Tag&Tag Free, Source: expressed from HEK293, Predicted N-terminus: Phe 23 (ITGA10) & Gln 21 (ITGB1), Molecular weight: 126.6 kDa (ITGA10) and 83.5 kDa (ITGB1), Synonyms: Integrin alpha 10 beta 1, ITGA10&ITGB1, Size: 100uG

Supplier: PeproTech, Inc.
Description: GDNF is a disulfide-linked, homodimeric neurotrophic factor structurally related to Artemin, Neurturin and Persephin. These proteins belong to the cysteine-knot superfamily of growth factors that assume stable dimeric protein structures. GDNF signals through a multicomponent receptor system, composed of a RET and one of the four GFRα (α1-α4) receptors. GDNF specifically promotes dopamine uptake and survival, and morphological differentiation of midbrain neurons. Using a Parkinson’s disease mouse model, GDNF has been shown to improve conditions such as bradykinesia, rigidity, and postural instability. The functional rat GDNF ligand is a disulfide-linked homodimer consisting of two 15 kDa polypeptide chains called monomers. Each monomer contains seven conserved cysteine residues, including Cys-101, which is used for inter-chain disulfide bridging, and others that are involved in the intramolecular ring formation known as the cysteine knot configuration. The calculated molecular weight of Recombinant Rat GDNF is 30.0 kDa.

Supplier: PeproTech, Inc.
Description: GDNF is a disulfide-linked, homodimeric neurotrophic factor structurally related to Artemin, Neurturin and Persephin. These proteins belong to the cysteine-knot superfamily of growth factors that assume stable dimeric protein structures. GDNF signals through a multicomponent receptor system, composed of a RET and one of the four GFRα (α1-α4) receptors. GDNF specifically promotes dopamine uptake and survival, and morphological differentiation of midbrain neurons. Using a Parkinson’s disease mouse model, GDNF has been shown to improve conditions such as bradykinesia, rigidity, and postural instability. The functional human GDNF ligand is a disulfide-linked homodimer consisting of two 15 kDa polypeptide chains called monomers. Each monomer contains seven conserved cysteine residues, including Cys-101, which is used for inter-chain disulfide bridging, and others that are involved in the intramolecular ring formation known as the cysteine knot configuration. The calculated molecular weight of Recombinant Human GDNF is 30.4 kDa.

Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
In order to process your orders without delay, we request that you provide the required business documentation to purchase this product.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • State issued document with your organization's Federal Tax ID Number
  • State issued document with your organization's Resale Tax ID Number
  • City or County issued Business License
  • State Department of Health Services License
  • Any other ID issued by the State that includes the business name and address

* Please note if your account is within the State of California two of these pieces of identification will be required.
VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
2,305 - 2,320 of 249,603
no targeter for Bottom