You Searched For: EXCELTA+CORPORATION

Catalog Number: (103007-450)

Supplier: Anaspec Inc

Description: This peptide corresponds to the GAP27 domain of connexin. Connexins, or gap junctions, are a family of structurally-related transmembrane proteins. This synthetic connexin-mimetic peptide, Gap 27, was used to evaluate the contribution of gap-junctional communication to osteoclastic bone resorption. It was concluded that gap-junctional communication is necessary for proper bone remodeling.
Sequence:SRPTEKTIFII
MW:1304.6 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Sale

Catalog Number: (10781-870)

Supplier: PeproTech, Inc.

Description: GDNF is a disulfide-linked, homodimeric neurotrophic factor structurally related to Artemin, Neurturin and Persephin. These proteins belong to the cysteine-knot superfamily of growth factors that assume stable dimeric protein structures. GDNF signals through a multicomponent receptor system, composed of a RET and one of the four GFRα (α1-α4) receptors. GDNF specifically promotes dopamine uptake and survival, and morphological differentiation of midbrain neurons. Using a Parkinson’s disease mouse model, GDNF has been shown to improve conditions such as bradykinesia, rigidity, and postural instability. The functional murine GDNF ligand is a disulfide-linked homodimer consisting of two 15.1 kDa polypeptide chains called monomers. Each monomer contains seven conserved cysteine residues, including Cys-101, which is used for inter-chain disulfide bridging, and others that are involved in the intramolecular ring formation known as the cysteine knot configuration. The calculated molecular weight of Recombinant Murine GDNF is 30.2 kDa.

Sale

Catalog Number: (89230-108)

Supplier: VWR

Description: Supplied as a 200X concentrate, Gold-N-Gel™ RNA Stain is a non-mutagenic, fluorescent in-gel stain for immediate visualization of RNA bands on denaturing agarose gels.

SDS Certificates Sale

Catalog Number: (103007-324)

Supplier: Anaspec Inc

Description: This is a PUMA (p53 upregulated modulator of apoptosis) BH3 domain peptide. PUMA together with Bcl-xL, and cytoplasmic p53 coordinate p53 functions. PUMA proteins bind Bcl-2, localize to the mitochondria, and induce cytochrome C release and apoptosis in response to p53. PUMA may be a direct mediator of p53-induced apoptosis.
Sequence:EEQWAREIGAQLRRMADDLNAQYER
MW:3049.3 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Supplier: PeproTech, Inc.

Description: Defensins (alpha and beta) are cationic peptides with a broad spectrum of antimicrobial activity that comprise an important arm of the innate immune system. The α-defensins are distinguished from the β-defensins by the pairing of their three disulfide bonds. To date, six human β-defensins have been identified; BD-1, BD-2, BD-3, BD-4, BD-5 and BD-6. β-defensins are expressed on some leukocytes and at epithelial surfaces. In addition to their direct antimicrobial activities, they can act as chemoattractants towards immature dendritic cells and memory T cells. The β-defensin proteins are expressed as the C-terminal portion of precursors, and are released by proteolytic cleavage of a signal sequence and, in some cases, a propeptide sequence. β-defensins contain a six-cysteine motif that forms three intra-molecular disulfide bonds. BD-4 is expressed in the testes, stomach, uterus, neutrophils, thyroid, lungs and kidneys. In addition to its direct antimicrobial activities, BD-4 is chemoattractant towards human blood monocytes. Recombinant Human BD-4 is a 6.0 kDa protein containing 50 amino acid residues.

Supplier: VWR

Description: Provides a safe, non-mutagenic alternative to ethidium bromide for instantaneous fluorescent DNA band visualization.

SDS Certificates

Catalog Number: (103003-050)

Supplier: Anaspec Inc

Description: Rat/mouse Amylin differs from the human version in 6 amino acids: H18R, F23L, A25P, I26V, S28P and S29P (first letter is the amino acid of the human sequence). Unlike the human IAPP (Amylin), rat Amylin does not form amyloid fibers.
Sequence: KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTY - NH2 (Disulfide bridge: 2 - 7)
MW: 3920.5 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C

Sale

Catalog Number: (103007-588)

Supplier: Anaspec Inc

Description: This is amino acids 54 to 65 fragment of sulfated hirudin, a 65-residue peptide. Hirudin is found in the saliva of the leech Hirudo medicinalis. This sulfated peptide binds tightly to anion-binding exosite I of thrombin, but does not inhibit hydrolysis of synthetic peptide substrates.
Sequence:Ac-GDFEEIPEE-Y(SO3H)-LQ
MW:1590.6 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Sale

Catalog Number: (103008-564)

Supplier: Anaspec Inc

Description: This peptide is the H2-Kd-restricted epitope of Listeriolysin O (LLO), consisting of amino acids 91 to 99. LLO is necessary for Listeria monocytogenes to escape the vacuoles of host cells and enter the cytoplasm during infection. This fragment has been shown to be a potential vaccine candidate against L. monocytogenes by eliciting a CTL response in vivo.
Sequence:GYKDGNEYI
MW:1058.1 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Catalog Number: (103008-718)

Supplier: Anaspec Inc

Description: Gliadin is a gluten component. This peptide is derived from amino acid residues 57-68 of a9-gliadin and represents an immunodominant epitope that has been shown to elicit HLA-DQ2-restricted T-cell responses in celiac patients. This epitope is resistant to pancreatic proteolysis.
Sequence: QLQPFPQPQLPY
MW: 1455.7 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Sale

Catalog Number: (103010-986)

Supplier: Anaspec Inc

Description: Tetramethylrhodamine iodoacetamides (TMRIA) are thiol-selective reactive dyes that are used to label proteins via the cysteine residues. 5-TMRIA, the pure 5-isomer of TMRIA, is increasingly preferred for some particular applications since the mixed isomers of TMRIA may give different results from batch to batch due to the varying ratios and different reactivities of the two isomers. For example, 5-TAMRA is reported to predominantly label SH-1 (Cys-707) of the myosin heavy chain in skinned muscle fibers.

Sale

Catalog Number: (470129-048)

Supplier: BRIGHT OF SWEDEN

Description: Intuitive and Hands-On Teaching Tool.

Sale

Catalog Number: (PAD1501)

Supplier: Promega Corporation

Description: Generates molecular weight size markers used in gel analysis of nucleic acids; nucleotide sequence has been determined.

Certificates Sale

Supplier: PeproTech, Inc.

Description: HVEM belongs to the TNF Receptor superfamily of transmembrane proteins, and plays a role in the activation of T-cells and other lymphocytes. It is expressed in various cells and tissues, including spleen, thymus, lung, macrophages, and T-cells. HVEM activation induces a signaling cascade that results in the induction of transcription factors NF-κB and AP-1. LIGHT (TNFSF14) and TNF-β (TNFSF1) function as the ligands for HVEM, which can also bind specifically to herpes simplex virus glycoprotein D. Soluble HVEM can act as a “receptor decoy” resulting in inhibition of the activity of the HVEM ligands, LIGHT and TNF-β. Recombinant Human HVEM-Fc is a 376 amino acid fusion protein that contains an N-terminal domain corresponding to the extracellular region of HVEM, and a C-terminal domain corresponding to residues 102 to 330 of human IgG1. The calculated molecular weight of Recombinant Human HVEM-Fc is 41.4 kDa.

Supplier: VWR

Description: TAE is an extensively used buffer for agarose gel electrophoresis applications requiring high resolution and separation of high molecular weight, double-stranded DNA

SDS Certificates

Supplier: PeproTech, Inc.

Description: GDNF is a disulfide-linked, homodimeric neurotrophic factor structurally related to Artemin, Neurturin and Persephin. These proteins belong to the cysteine-knot superfamily of growth factors that assume stable dimeric protein structures. GDNF signals through a multicomponent receptor system, composed of a RET and one of the four GFRα (α1-α4) receptors. GDNF specifically promotes dopamine uptake and survival, and morphological differentiation of midbrain neurons. Using a Parkinson’s disease mouse model, GDNF has been shown to improve conditions such as bradykinesia, rigidity, and postural instability. The functional murine GDNF ligand is a disulfide-linked homodimer consisting of two 15.1 kDa polypeptide chains called monomers. Each monomer contains seven conserved cysteine residues, including Cys-101, which is used for inter-chain disulfide bridging, and others that are involved in the intramolecular ring formation known as the cysteine knot configuration. The calculated molecular weight of Recombinant Murine GDNF is 30.2 kDa.