You Searched For: Molecular+Bioproducts+Inc.

377,182 results were found

Refine Results Sort by

Sort Results

List View Easy View (new)

Compare(0) Clear

Rate These Search Results

Human Recombinant MCP-1 (from E. coli)

Catalog Number: (76303-830)

Supplier: PeproTech, Inc.

Description: The MCP proteins are members of the CC chemokine family that signal through CCR2 and, with the exception of MCP-1, other CCR receptors. The MCP proteins chemoattract and activate monocytes, activated T cells, basophils, NK cells, and immature dendritic cells. The MCP family cross-reacts across species. Recombinant Human MCP-1 is an 8.6 kDa protein containing 76 amino acid residues, including the four highly conserved cysteine residues present in the CC chemokines.

Sale

Retrieving Each

Human Beta-Amyloid (1-42), Biotin

Supplier: Anaspec Inc

Description: Biotinylated forms of Aβ are used commonly for interaction studies. Studies have revealed that biotinylation of a lysine at the C-terminus or N-terminal biotinylation of the beta-amyloid peptides influences the secondary structure conformation.
This beta-amyloid 1-42 peptide is biotinylated to a lysine residue attached to the C-terminal end.
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-K(Biotin)-NH2
MW: 4867.6 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

[Lys(Ac)9]-Histone H3 (1-21)-GGK,Biotin

Supplier: Anaspec Inc

Description: This peptide is Histone H3 amino acid residues 1 to 21 acetylated at Lys-9 with a C-terminal GG linker followed by a biotinylated lysine. Provided at >95% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.
Sequence:ARTKQTAR-K(Ac)-STGGKAPRKQLA-GGK(Biotin)
MW:2765.3 Da
% peak area by HPLC:95
Storage condition:-20° C

Mouse Recombinant BD-3 (from E. coli)

Supplier: PeproTech, Inc.

Description: Defensins (alpha and beta) are cationic peptides with a broad spectrum of antimicrobial activity that comprise an important arm of the innate immune system. The alpha-defensins are distinguished from the beta-defensins by the pairing of their three disulfide bonds. To date, six human beta-defensins have been identified; BD-1, BD-2, BD-3, BD-4, BD-5 and BD-6. beta-defensins are expressed on some leukocytes and at epithelial surfaces. In addition to their direct antimicrobial activities, they can act as chemoattractants towards immature dendritic cells and memory T cells. The beta-defensin proteins are expressed as the C-terminal portion of precursors, and are released by proteolytic cleavage of a signal sequence and, in some cases, a propeptide sequence. Beta-defensins contain a six-cysteine motif that forms three intra-molecular disulfide bonds. Recombinant Murine BD-3 is a 4.6 kDa protein containing 41 amino acid residues.

Mouse Mgp100 (25-33)

Catalog Number: (103008-430)

Supplier: Anaspec Inc

Description: This peptide sequence is found in residues 25 to 33 of the mouse self/tumor antigen glycoprotein (mgp100). This fragment is a H-2Db–restricted epitope recognized by CD8+ T cells. Mgp100 is an enzyme normally involved in pigment synthesis, and the epitope fragment is typically expressed in both normal melanocytes and melanoma cells.
Sequence:EGSRNQDWL
MW:1104.2 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Retrieving Each

DNA-PK Substrate

Catalog Number: (103005-904)

Supplier: Anaspec Inc

Description: A substrate for DNA-dependent protein kinase (DNA-PK), phosphorylation. DNA-PK is essential for the repair of DNA double-strand breaks. This peptide corresponding to 11–24 amino acids of human p53 with threonine 18 and serine 20 changed to alanine is used as a substrate for the assay of DNA-PK activity
Sequence:EPPLSQEAFADLWKK
MW:1759 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Retrieving Each

Mouse Recombinant VEGF R2 (from HEK293 cells)

Catalog Number: (103790-880)

Supplier: ACROBIOSYSTEMS

Description: Mouse VEGF R2 / KDR Protein, Mouse IgG2a Fc Tag, low endotoxin, ACROBiosystems

Sale

Retrieving Each

Human Recombinant IGF-BP6 (from (BTI-Tn-5B1-4) Hi-5 Insect cells)

Supplier: PeproTech, Inc.

Description: IGF-BPs control the distribution, function and activity of IGFs in various cell tissues and body fluids. IGF-BP6, which specifically inhibits IGF-II actions, is produced by bone cells and is the major IGF-BP present in cerebrospinal fluid. IGF-BP6 has been shown to inhibit IGF-II-dependent cancers such as neuroblastoma, colon cancer and rhabdomyosarcoma. Recombinant Human IGF-BP6 has a calculated mass of 22.3 kDa and consists of 213 amino acid residues, including the IGF-BP domain and thyroglobulin type-I domain. Recombinant Human IGF-BP6 migrates at an apparent molecular weight of approximately 23.0-30.0 kDa by SDS-PAGE analysis under non-reducing conditions.