Print…

You Searched For: Molecular+Bioproducts+Inc.


377,217  results were found

Refine Results Sort by
SearchResultCount:"377217"

Sort Results

List View Easy View (new)

Rate These Search Results

Image Unavailable-103015-222

Human recombinant PSME3 (from E. coli)

Catalog Number: (103015-222)
Supplier: ACROBIOSYSTEMS
Description: PSME3/PA28g Protein, Host: E.coli, Species Reactivity: Human, Purity: >95% by SDS-PAGE, Molecular Characterization: fused with a polyhistidine tag at the N-terminus, calculated MW of 30.3 kDa, Synonym: PSME3,PA28gamma,PA28g, Storage: 4 degree Celcius, Size: 100ug
Image Unavailable-103013-894

Human Recombinant UCH-L1 (from E. coli)

Supplier: ACROBIOSYSTEMS
Description: UCH-L1 Protein, Host: E.coli, Species Reactivity: Human, Purity: >92% (SDS-PAGE), Molecular Characterization: rh UCHL1 is fused with a polyhistidine tag at the N-terminus, with calculated MW of of 25.7 KDa, Synonyms: UCHL1,PGP9.5, Storage: 4 degree C, Size: 1mg

Image Unavailable-103008-590

Autocamtide-3-Related Inhibitory Peptide

Catalog Number: (103008-590)
Supplier: Anaspec Inc
Description: This is a myristoylated form of Autocamtide-3-Derived Inhibitory Peptide (AC3-I), a highly specific inhibitor of Calmodulin-Dependent Protein Kinase ll (CaMKII) that is resistant to proteolysis. AC3-I is derived from Autocamtide-3, a substrate for CaMKII, with the Thr-9 phosphorylation site substituted with Ala.
Sequence:Myr-KKALHRQEAVDAL
MW:1689.1 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103007-230

Psi-RACK, epsilon-C2/V1 (82-92)

Catalog Number: (103007-230)
Supplier: Anaspec Inc
Description: This peptide is the e-PKC specific activator, it also activates MARCKS phosphorylation in wild type cells, and has no effect on MARCKS phosphorylation in the cells derived from knockout mice.
Sequence:HDAPIGYD
MW:886.9 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103014-236

Human Recombinant CD300LG (from HEK293 Cells)

Supplier: ACROBIOSYSTEMS
Description: CD300LG / Nepmucin Protein, Host: HEK293 Cell, Species Reactivity: Human, Purity: >95%, Molecular Characterization: Fused with 6xHis tag at the C-terminus, MW of 25.6 kDa, Synonym: CD300LG, CLM9, TREM4, CD300g, Nepmucin, Storage: 4 deg C, Size: 1MG

Image Unavailable-103007-640

Human [Cys26]-beta-Amyloid (1-42)

Supplier: Anaspec Inc
Description: This peptide is beta-amyloid (1-42) with substitution of Ser26 to Cys. This peptide has been used in a number of fluorescent tagged experiments and suited for fluorescent probe labeling.
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGCNKGAIIGLMVGGVVIA
MW: 4530.2 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Image Unavailable-103013-990

Ebolavirus Recombinant Glycoprotein / GP (virus) (from HEK293 cells)

Supplier: ACROBIOSYSTEMS
Description: Recombinant EBOV(subtype Zaire,strain Kikwit-95) Envelope Glycoprotein 1(GP1), Host: HEK293 cells, Species: Ebolavirus, Purity: >95%(SDS-PAGE), Molecular Characterization: Polyhistidine tag at C-terminus, 51.6KDa, Synonym: GP1,GP, Size: 100ug

Image Unavailable-103013-994

Ebolavirus Recombinant Glycoprotein / GP (virus) (from HEK293 cells)

Supplier: ACROBIOSYSTEMS
Description: Recombinant EBOV(subtype Zaire,strain Kikwit-95) Envelope Glycoprotein(GP), Host: HEK293 cells, Species: Ebolavirus, Purity: >85%(SDS-PAGE), Molecular Characterization: Polyhistidine tag at C-terminus, 67KDa, Synonym: GP1,GP, Size: 100ug

Image Unavailable-103014-558

Human Recombinant IGF-I R (from HEK293 cells)

Supplier: ACROBIOSYSTEMS
Description: IGF-I R / CD221 Protein, Host: HEK293 Cells, Species Reactivity: Human, purity: >95%, Molecular Characterization: polyhistidine tag at the C-terminus, MW of 104 kDa, Synonym: IGF1R, CD221, IGFR, JTK13, CD221, MGC142170, Storage: 4 deg C, Size: 1MG

Image Unavailable-103015-310

Human Recombinant R-Spondin 1 (from HEK293 Cells)

Supplier: ACROBIOSYSTEMS
Description: R-Spondin 1/RSPO1 Protein, Host: HEK293, Species Reactivity: Human, Purity: >95%, Molecular Characterization: fused with a polyhistidine tag at the C-terminus, MW of 27.6 kDa, Synonym: RSPO1,CRISTIN3,FLJ40906,RP11-566C13.1,R-spondin-1, Storage: 4 deg C, Size: 1mg

Image Unavailable-103014-370

Human Recombinant G-CSF R (from HEK293 Cells)

Supplier: ACROBIOSYSTEMS
Description: G-CSF R / CD114 Protein, Host: HEK293 Cell, Species Reactivity: Human, Purity: >95%, Molecular Characterization: His Tag is fused with a polyhistidine tag at C-terminal, MW of 69 kDa, Synonym: CSF3R,CD114,GCSFR, Storage: 4 deg C, Size: 1MG

Image Unavailable-103014-610

Human Recombinant IL-1 RII (from HEK293 cells)

Supplier: ACROBIOSYSTEMS
Description: IL-1 RII / CD121b Protein, Host: HEK293 Cells, Species Reactivity: Human, purity: >98%, Molecular Characterization: polyhistidine tag at the C-terminus, calculated MW of 38.6 kDa, Synonym: CD121b,IL1RB,IL1R2,CDw121b, Storage: 4 deg C, Size: 1MG

Image Unavailable-103013-208

HIV-1 (CN54) Recombinant GP120 (from HEK293 cells)

Supplier: ACROBIOSYSTEMS
Description: Recombinant [HIV-1/Clade B/C (CN54)] GP120, Host: HEK293 Cells, Species reactivity: HIV, Purity: >97% SDS-PAGE, Molecular Characterization: Fused with a polyhistidine tag at the C-terminus, MW of 53.8 kDa, Synonym: GP120, GP120-CN54, Size: 100ug

Image Unavailable-103014-798

Human Recombinant Integrin alpha V beta 6 (from HEK293 Cells)

Supplier: ACROBIOSYSTEMS
Description: Integrin alpha V beta 6 (ITGAV&ITGB6) Heterodimer Protein, Host: HEK293 Cells, Species Reactivity: Human, purity: >95%, Molecular Characterization: MW of 113 kDa, Synonym: Integrin alpha V beta 6, ITGAV&ITGB6, Storage: 4 deg C, Size: 1MG

Image Unavailable-103015-036

Human Recombinant Neuropilin-1 (from HEK293 Cells)

Supplier: ACROBIOSYSTEMS
Description: Neuropilin-1/NRP1/CD304 Protein, Host: HEK293, Species Reactivity: Human, Purity: >92% by SDS-PAGE, Molecular Characterization: fused with a polyhistidine tag at C-terminus, MW of 70.7 kDa, Synonym: NRP1,Neuropilin-1,NRP,CD304, Storage: 4 deg C, Size: 1mg

Image Unavailable-103014-252

Human Recombinant CEACAM-6 (from HEK293 Cells)

Supplier: ACROBIOSYSTEMS
Description: CEACAM-6 / CD66c Protein, Host: HEK293 Cell, Species Reactivity: Human, Purity: >95%, Molecular Characterization: His Tag is fused with a polyhistidine tag at C-terminus , MW of 32 kDa, Synonym: CEACAM6,CD66c,CEAL,NCA, Storage: 4 deg C, Size: 1MG

Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
In order to process your orders without delay, we request that you provide the required business documentation to purchase this product.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • State issued document with your organization's Federal Tax ID Number
  • State issued document with your organization's Resale Tax ID Number
  • City or County issued Business License
  • State Department of Health Services License
  • Any other ID issued by the State that includes the business name and address

* Please note if your account is within the State of California two of these pieces of identification will be required.
VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
833 - 848 of 377,217
no targeter for Bottom