Human [Cys26]-beta-Amyloid (1-42)

Supplier: Hytest Ltd
Ratings: (No Reviews)

Total Ratings: 0
Avg. Ratings: 0.0 out of 5

AS-63672-05 AS-63672-1
103007-638EA 464.77 USD
103007-638 103007-640
Human [Cys26]-beta-Amyloid (1-42)
Proteins and Peptides

This peptide is beta-amyloid (1-42) with substitution of Ser26 to Cys. This peptide has been used in a number of fluorescent tagged experiments and suited for fluorescent probe labeling.
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGCNKGAIIGLMVGGVVIA
MW: 4530.2 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Order Now


Learn more

About VWR

Avantor is a vertically integrated, global supplier of discovery-to-delivery solutions for...

Learn more About VWR