You Searched For: sander


3  results were found

SearchResultCount:"3"

Sort Results

List View Easy View (new)

Rate These Search Results

Catalog Number: (102996-550)
Supplier: Anaspec Inc
Description: [Met5]-Enkephalin, Purity: HPLC >/= 95%, Molecular Weight: 573.8, Sequence: H-Tyr-Gly-Gly-Phe-Met-OH, Appearance: Solid, Storage: -20 deg C, Size: 25 mg


Catalog Number: (10778-728)
Supplier: PeproTech, Inc.
Description: Recombinant Human BD-5, 57.8 kDa protein containing 51 amino acid residues, Beta-defensins contain a six-cysteine motif that forms three intra-molecular disulfide bonds, Animal-Free Cytokines, Source: E.coli, >98%, Synonyms: BD5, DEFB5, DEFB105a, Beta-Defensin 5, 100UG


Catalog Number: (10778-732)
Supplier: PeproTech, Inc.
Description: Recombinant Human BD-5, 57.8 kDa protein containing 51 amino acid residues, Beta-defensins contain a six-cysteine motif that forms three intra-molecular disulfide bonds, Animal-Free Cytokines, Source: E.coli, >98%, Synonyms: BD5, DEFB5, DEFB105a, Beta-Defensin 5, 500UG


Catalog Number: (10778-734)
Supplier: PeproTech, Inc.
Description: Recombinant Human BD-5, 57.8 kDa protein containing 51 amino acid residues, Beta-defensins contain a six-cysteine motif that forms three intra-molecular disulfide bonds, Animal-Free Cytokines, Source: E.coli, >98%, Synonyms: BD5, DEFB5, DEFB105a, Beta-Defensin 5, 1MG


Catalog Number: (10778-730)
Supplier: PeproTech, Inc.
Description: Recombinant Human BD-5, 57.8 kDa protein containing 51 amino acid residues, Beta-defensins contain a six-cysteine motif that forms three intra-molecular disulfide bonds, Animal-Free Cytokines, Source: E.coli, >98%, Synonyms: BD5, DEFB5, DEFB105a, Beta-Defensin 5, 250UG


Catalog Number: (10778-726)
Supplier: PeproTech, Inc.
Description: Recombinant Human BD-5, 57.8 kDa protein containing 51 amino acid residues, Beta-defensins contain a six-cysteine motif that forms three intra-molecular disulfide bonds, Animal-Free Cytokines, Source: E.coli, >98%, Synonyms: BD5, DEFB5, DEFB105a, Beta-Defensin 5, 20UG


Catalog Number: (10778-724)
Supplier: PeproTech, Inc.
Description: Recombinant Human BD-5, 57.8 kDa protein containing 51 amino acid residues, Beta-defensins contain a six-cysteine motif that forms three intra-molecular disulfide bonds, Animal-Free Cytokines, Source: E.coli, >98%, Synonyms: BD5, DEFB5, DEFB105a, Beta-Defensin 5, 5UG


Catalog Number: (103815-204)
Supplier: ACROBIOSYSTEMS
Description: IL-17 RE (155-454) Protein, Species Reactivity: Human, Host: HEK293, Purity: >95% as determined by SDS-PAGE, Molecular Weight: 60.5 kDa, Molecular Characterization: protein carries a human IgG1 Fc tag at C-terminus, Synonym: IL-17 RE, IL17RE, Size: 1mg


Catalog Number: (103815-206)
Supplier: ACROBIOSYSTEMS
Description: IL-17 RE (155-454) Protein, Species Reactivity: Human, Host: HEK293, Purity: >95% determined by SDS-PAGE, Molecular Weight: 60.5 kDa, Molecular Characterization: protein carries human IgG1 Fc tag at C-terminus, Synonym: IL-17 RE, IL17RE, IL17RE, Size: 100ug


Catalog Number: (103006-910)
Supplier: Anaspec Inc
Description: Histone H3 (1-21), N-Terminal, used as a substrate for methylation and acetylation assays, Purity: HPLC >/=95%, Sequence (One-Letter Code): ARTKQTARKSTGGKAPRKQLA, Molecular weight: 2254.6, Appearance: Lyophilized white powder, Storage: -20 degree C, Size: 1 mg


Catalog Number: (103007-484)
Supplier: Anaspec Inc
Description: Dyrktide, Sequence: RRRFRPASPLRGPPK, Purity: By HPLC greater than or equal to 95%, optimal substrate sequence efficiently phosphorylated by DYRK1A involved in brain development, Molecular Weight: 1791.2, Apperance: White powder, Storage: -20 deg C, Size: 1 mg


Catalog Number: (103007-250)
Supplier: Anaspec Inc
Description: HA 12CA5 Epitope, Sequence: CYPYDVPDYA, Purity: By HPLC greater than or equal to 95%, epitope tag from hemophilus influenza is recognized by the common monoclonal antibody 12Ca5, Molecular Weight: 1205.3, Storage: -20 deg C, Size: 1 mg


Catalog Number: (103007-526)
Supplier: Anaspec Inc
Description: Beta-Amyloid (3-42), Human, Sequence: EFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA, Purity: By HPLC greater than or equal to 95%, Molecular Weight: 4327.9, Apperance: Lyophilized white powder, Storage: -20 deg C, Size: 1 mg


Catalog Number: (103007-678)
Supplier: Anaspec Inc
Description: Myristolated PKC Zeta, Pseudosubstrate ZIP, Scrambled, Sequence: Myristoyl-RLYRKRIWRSAGR, Purity: By HPLC >/= 95%, used as a control for ZIP as it has identical amino acids as that of ZIP, Molecular Weight: 1928.5, Storage: -20 C, Size: 1 mg


Catalog Number: (102996-522)
Supplier: Anaspec Inc
Description: Beta-Amyloid (1-39), Purity: HPLC >/= 95%, Molecular Weight: 4230.7, Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGV, Appearance: Lyophilized white powder, identified as the major components of the cerebral amyloid deposits in Alzheimer’s disease, Size: 1 mg


Catalog Number: (103815-272)
Supplier: ACROBIOSYSTEMS
Description: MIS RII Protein, Species Reactivity: Human, Host: HEK293, Molecular Weight: 40.0 kDa, Molecular Characterization: protein carries a human IgG1 Fc tag at the C-terminus, Synonym: MIS RII, MRII, AMHR2, AMHR, MISR2, AMH type II receptor, Storage: lyophilized state at -20 deg C or lower, Size: 1mg


Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
In order to process your orders without delay, we request that you provide the required business documentation to purchase this product.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • State issued document with your organization's Federal Tax ID Number
  • State issued document with your organization's Resale Tax ID Number
  • City or County issued Business License
  • State Department of Health Services License
  • Any other ID issued by the State that includes the business name and address

* Please note if your account is within the State of California two of these pieces of identification will be required.
VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
no targeter for Bottom