You Searched For: BOSTER BIOLOGICAL TECHNOLOGY CO LTD


5  results were found

Sort Results

List View Easy View (new)
SearchResultCount:"5"
Description: Cytoglobin Picoband, Polyclonal Antibody, Host: Rabbit, Species Reactivity: Human, Mouse, Rat, Immunogen: E.coli-derived human Cytoglobin recombinant protein (Position: M1-P190, Synonym: STAP, Application: IHC-P, WB, Size:100ug
Catalog Number: 76171-362
Supplier: Boster Biological Technology


Description: Bid antibody, polyclonal, Host: Rabbit, Isotype: IgG, Species reactivity: Mouse, Rat, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of mouse Bid(179-195aa NQNLFSYVRNLVRNEMD), different from the related rat sequence by one amino acid.
Catalog Number: 10208-848
Supplier: Boster Biological Technology


Description: Serum Amyloid P Picoband* antibody, Polyclonal, Host: Rabbit IgG, Reactivity: Mouse, Immunogen: E.coli-derived mouse Serum Amyloid P recombinant protein (Position: Q21-D224).
Catalog Number: 10206-302
Supplier: Boster Biological Technology


Description: Doublecortin Picoband, Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Rat, Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human Doublecortin (74-100aa), Synonym: DCX, DBCN, LISX, Application: WB, Size:100ug
Catalog Number: 76171-280
Supplier: Boster Biological Technology


Description: Sandwich PicoKine* ELISA kit of Quantitative Detection for Human DLL1, Immunogen: NSO, S22-G540, Assay range: 78pg/ml-5000pg/ml, Sensitivity: > 10 pg/ml, Sample type: cell culture supernates, serum, plasma(heparin, EDTA), urine and human milk, 96-well plate precoated
Catalog Number: 10205-794
Supplier: Boster Biological Technology


Description: Legumain(Total) PicoKine* ELISA Kit, Sensitivity: <10pg/ml, Sample type: cell culture supernates, cell lysates, serum and plasma (heparin, EDTA), Species: Mouse, Assay: 31.2pg/ml, Sandwich High Sensitivity for Quantitative Detection, Size: 96wells/kit
Catalog Number: 76172-722
Supplier: Boster Biological Technology


Description: DKK-4 / Dickkopf 4 ELISA Kit, Reactivity: Human, Sample Type: cell culture supernatants, serum and plasma, Sample Volume: 100ul per well, Sensitivity: <10pg/ml, Assay Range: 156-10000pg/ml, Alternative Names: Dkk-4, dickkopf (Xenopus laevis) homolog 4, Size: 96wells/kit, with removable strips.
Catalog Number: 76466-376
Supplier: Boster Biological Technology


Description: BCAR3 Picoband*, Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Rat, Isotype: IgG, Immunogen: 791-825aa KGAQVNQTERYEKFNQILTALSRKLEPPPVKQAEL, Synonyms: Breast cancer anti-estrogen resistance protein 3, storage: -20 deg C, size: 100ug/vial
Catalog Number: 76174-548
Supplier: Boster Biological Technology


Description: Picoband*HnRNP H Polyclonal antibody, Host: Rabbit, Species: Human, Immunogen: Synthetic peptide corresponding to a sequence at the N-terminus of human HnRNP H, Synonyms: Heterogeneous nuclear ribonucleoprotein H, hnRNP H, Uses: WB, Size: 100ug/vial
Catalog Number: 76172-002
Supplier: Boster Biological Technology


Description: PARP Picoband* Polyclonal Antibody, Host: Rabbit, Species reactivity: Human, Mouse, Rat, Immunogen: E.coli-derived human PARP recombinant protein (Q670-R858), Synonyms: Poly [ADP-ribose] polymerase 1, Application: IHC-P, ICC, WB, size: 100ug/vial
Catalog Number: 76173-452
Supplier: Boster Biological Technology


Description: CNPase Picoband, Polyclonal Antibody, Host: Rabbit, Species Reactivity: Human, Mouse, Rat, Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human CNPase (142-178aa), Synonym: CNP, Application: WB, Size:100ug
Catalog Number: 76170-880
Supplier: Boster Biological Technology


Description: E74 like factor 1 Picoband, Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Rat, Immunogen: A synthetic peptide corresponding to a sequence of human E74 like factor 1 (QPTQSPYPTQLFRTVHVVQPVQAVPEGEaa), Synonym: ELF1, Application: WB, Size:100ug
Catalog Number: 76171-722
Supplier: Boster Biological Technology


Description: Chinese Hamster BMP-7 PicoKine* ELISA Kit, Sensitivity: <10pg/ml, Sample type: bone tissue, cell culture supernates, serum and plasma(heparin, EDTA), Species reactivity: Hamster, Assay: 31.2pg/ml, Sandwich High Sensitivity, Size: 96wells/kit
Catalog Number: 76172-534
Supplier: Boster Biological Technology


Description: Sandwich PicoKine* ELISA kit of Quantitative Detection for Mouse VEGFR3/FLT4 Immunogen: NSO, Y25-D770 Assay range: 156pg/ml-10, 000pg/ml Sensitivity: < 10 pg/ml, Sample Type: cell culture supernates and serum, 96-well plate precoated
Catalog Number: 10209-892
Supplier: Boster Biological Technology


Description: IL11 Picoband, Polyclonal Antibody, Host: Rabbit, Species Reactivity: Mouse, Rat, Immunogen: E. Coli-derived rat IL11 recombinant protein (Position: P25-L199), Synonym: Interleukin-11, IL-11, Il11, Application: ELISA, WB, Size:100ug
Catalog Number: 76171-348
Supplier: Boster Biological Technology


Description: Chicken TGF-Beta 2 PicoKine* ELISA Kit, Sensitivity: <10pg/ml, Sample type: cell culture supernates, serum and plasma(heparin, EDTA, citrate), Species reactivity: Chicken, Assay Range: 31.2pg/ml, Sandwich High Sensitivity, Size: 96wells/kit
Catalog Number: 76172-290
Supplier: Boster Biological Technology