Catalog Number: (103009-020)

Supplier: Anaspec Inc

Description: This peptide is a 5-FAM-labeled cylic RGDyK peptide. RGD peptides serve as ligands for av-integrin and inhibit angiogenesis, induce endothelial apoptosis, decrease tumor growth, and reduce spread of metastasis.
Sequence:Cyclo[-RGDy-K(5-FAM)]
MW:978 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Catalog Number: (103006-056)

Supplier: Anaspec Inc

Description: Protection activity of humanin (HN) against neuronal cell death is abrogated in this peptide, where Cys8 is substituted by Ala.
Sequence:MAPRGFSALLLLTSEIDLPVKRRA
MW:2655.2 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Catalog Number: (103005-290)

Supplier: Anaspec Inc

Description: This Ghrelin peptide is biotinylated at the peptide N-terminus. Ghrelin is an appetite stimulating peptide hormone secreted by stomach P/D1-type cells in humans and circulates in the bloodstream during fasting conditions.  Enzymatically n-octanoylated Serine3 of this 28-amino acid Ghrelin is the endogenous ligand specific for growth hormone secretagogue receptor 1a (GHSR1a). The GHSR1a receptor appears to be dedicated to Ghrelin and is widely expressed in different tissues. 
Sequence: Biotin-GS-S(n-octanoyl)-FLSPEHQRVQQRKESKKPPAKLQPR
MW: 3597.2 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Sale

Catalog Number: (103011-144)

Supplier: Anaspec Inc

Description: Cell-permeant DNA minor groove binding dye

Sale

Catalog Number: (102996-530)

Supplier: Anaspec Inc

Description: Dynorphins are a class of opioid peptides that arise from the precursor protein prodynorphin. Upon cleavage by proprotein convertase 2 (PC2), multiple active peptides are released: dynorphin A, dynorphin B, and α/β-neo-endorphin. Dynorphins exert their effects primarily through the κ-opioid receptor (KOR), a G-protein-coupled receptor. Dynorphin has been shown to be a modulator of pain response, involved in drug addiction and appetite control.
Sequence:YGGFLRRI
MW:981.2 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Catalog Number: (103010-160)

Supplier: Anaspec Inc

Description: Matrix metalloproteinases (MMPs) belong to a family of secreted or membrane-associated proteins capable of digesting extracellular matrix components

Sale

Supplier: Anaspec Inc

Description: This peptide is a HCV protease substrate incorporating an ester bond between residues P1 and P1. Due to ready transesterification of the scissile bond to the acyl-enzyme intermediate, this substrate shows very high kcat/Km values, enabling detection of activity with subnanomolar nonstructural protein 3 (NS3 protease) concentrations. It is widely used for the continuous assay of NS3 protease activity. Substrate cleavage is proportional to the enzyme concentration with a detection limit for NS3 between 1 nM and 250 pM. Upon cleavage of this substrate, fluorescence can be monitored at Abs/Em = 355/500 nm.

Catalog Number: (103006-122)

Supplier: Anaspec Inc

Description: This is a BCL2-antagonist of cell death peptide fragment that is fluorescently labeled with FAM, Abs/Em=494/521 nm.
Sequence:FAM-NLWAAQRYGRELRRMSDEFVDSFKK
MW:3461.8 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Catalog Number: (103008-200)

Supplier: Anaspec Inc

Description: This GLP-1 (7-36) amide peptide is fluorescently labeled at Tryptophan residue 25 with Fluorescein. This is the same type of fluorescent labeling as in Extendin-4 Flex peptide (Cat# AS-63899). GLP-1 (7-36) amide is an incretin hormone that causes glucose dependent release of insulin by pancreatic beta cells. It is the cleavage product of GLP-1 (1-36) amide peptide (cat# AS-22460). Both GLP-1 (7-36) and GLP-1 (7-37) - Cat# AS-20761, also play roles in gastric motility (gastric emptying), on the suppression of plasma glucagon levels (glucose production) and possibly on the promotion of satiety and stimulation of glucose disposal in peripheral tissues independent of the actions of insulin. GLP-1 (7-36) has a short half life of less than 2 minutes, and like GIP, is rapidly degraded by the enzyme dipeptidyl peptidase IV (DPP-4), which is widely expressed in a number of sites, including the endothelial cells of small gut arterioles. DPP-4 degrades GLP-1 (7-36) into the non insulinotropic GLP-1 (9-36) - Cat# AS-65070 (some studies suggest it may have weak insulinotropic activity). As a result, the majority of GLP-1 (and GIP) is inactivated as an insulinotrope before reaching the systemic circulation.
Sequence: HAEGTFTSDVSSYLEGQAAKEFIA (Trp-S-FAM)-LVKGR-NH2
MW: 3717.5 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Sale

Catalog Number: (103011-026)

Supplier: Anaspec Inc

Description: 5-FTSC reacts with ketones to yield relatively stable hydrazones and with aldehydes to yield hydrazones that are somewhat less stable, though they may be formed faster (compared to ketones). These hydrazones are generally reduced with sodium borohydride (NaBH4) to further increase the stability of the linkage. 5-FTSC has been used to make a wide variety of biomolecules such as L-aspartase-a-decarboxylase, enzyme-oxidized live plant protoplasts, immunoglobulins, thrombin and antithrombin.

Sale

Catalog Number: (103009-918)

Supplier: Anaspec Inc

Description: This peptide is Histone 3, with amino acid residues 21 to 44. It is dimethylated at Lys27 and monomethylated Lys36, with a C-terminal G linker followed by a biotinylated lysine. Histone methylation plays an important role in the regulation of chromatin structure and function. 
Sequence:ATKAAR-K(Me2)-SAPATGGV-K(Me1)-KPHRYRPG-GK(Biotin)
MW:2959.5 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Catalog Number: (103010-482)

Supplier: Anaspec Inc

Description: Renin, a highly specific aspartyl protease, cleaves angiotensinogen, to yield angiotensin I, which is further converted into angiotensin II by ACE (Angiotensin Converting Enzyme)

Sale

Catalog Number: (103010-952)

Supplier: Anaspec Inc

Description: Spectrally similar to Cy7 dye, HiLyte™ Fluor 750 C2 maleimide is the longest-wavelength thiol-reactive HiLyte™ Fluor dye currently available.

Sale

Catalog Number: (103009-978)

Supplier: Anaspec Inc

Description: Beclin-1 peptide is the HIV-1 Nef binding portion of full-length human Beclin-1 protein (amino acids 267-299). Beclin-1 protein is an autophagy inducing agent that may trigger cellular adaptation, survival or cell death. When conjugated to the cell-permeable peptide, it can successfully enter cells and induce autophagy. Tat-Beclin-1, scrambled will not induce autophagy and can be used as a negative control. RELATED PRODUCTS:Tat-Beclin-1, Cat# 65467Beclin-1, Cat# 65466
Sequence: YGRKKRRQRRRGGVGNDFFINHETTGFATEW
MW: 3741.1 Da
% Peak area by HPLC: 95
Storage condition: -20°C

Sale

Catalog Number: (103007-370)

Supplier: Anaspec Inc

Description: This GRG containing peptide is amino acids 1 to 20 fragment of histone 4. It is a substrate for human protein-arginine methyltransferase 7 (PRMT7), a type II methyltransferase capable of producing symmetrical dimethyl arginine (sDMA) modifications in proteins.
Sequence:SGRGKGGKGLGKGGAKRHRK-NH2
MW:1991.3 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Supplier: Anaspec Inc

Description: This peptide corresponds to the CtoN inverted sequence of Beta-amyloid 40-1.
Sequence: VVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD
Molecular Weight: 4329.9 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C