Print…

You Searched For: 4-Iodobenzyl alcohol


377,137  results were found

Refine Results Sort by

Sort Results

List View Easy View (new)
SearchResultCount:"377137"

Rate These Search Results

Image Unavailable-103006-890

Rat 26Rfa, Hypothalamic Peptide

Description: 26Rfa is a neuropeptide belonging to the RFamide peptide family. It exhibits orexigenic activity and has been associated to obesity. The primary structures of human, rat, and frog 26RFa exhibit 80% identity, and the C-terminal octapeptide is fully conserved from amphibians to mammals.
Sequence:ASGPLGTLAEELSSYSRRKGGFSFRF-NH2
MW:2820.2 Da
% peak area by HPLC:95
Storage condition:-20° C
Catalog Number: 103006-890
Supplier: Anaspec Inc
Image Unavailable-103888-002

Mouse Recombinant Integrin alpha 2 beta 1 (from HEK293), Unconjugated

Description: Mouse Integrin alpha 2 beta 1 (ITGA2&ITGB1) Heterodimer Protein, His Tag&Tag Free, Source: expressed from HEK293, Predicted N-terminus: Tyr 27 (ITGA2) & Gln 21 (ITGB1), Molecular weight: 127.6 kDa (ITGA2) and 83.5 kDa (ITGB1), Synonyms: Integrin alpha 2 beta 1, ITGA2 & ITGB1, Size: 100uG
Catalog Number: 103888-002
Supplier: ACROBIOSYSTEMS
Image Unavailable-103871-150

SARS-CoV-2 Recombinant S protein (from HEK293 cells)

Description: SARS-CoV-2 S protein, His Tag, Super stable trimer (MALS & NS-EM verified), ACROBiosystems
Catalog Number: 103871-150
Supplier: ACROBIOSYSTEMS
Image Unavailable-103888-440

Human Recombinant Integrin alpha X beta 2 (from HEK293), Unconjugated

Description: Human Integrin alpha X beta 2 (ITGAX&ITGB2) Heterodimer Protein, His Tag&Tag Free, Source: expressed from HEK293, Predicted N-terminus: Phe 20 (ITGAX) & Gln 23 (ITGB2), Molecular weight: 126.5 kDa (ITGAX) and 80.2 kDa (ITGB2), Synonyms: Integrin alpha X beta 2, ITGAX&ITGB2, Size: 1mg
Catalog Number: 103888-440
Supplier: ACROBIOSYSTEMS
Image Unavailable-102996-470

Human Thrombin Receptor Activator for Peptide 6

Description: This sequence acts as a tethered peptide ligand. Free SFLLRN activates PAR1 independent of receptor cleavage and has been used to probe PAR1 function in various cells and tissues. This peptide is also known to be capable of activating PAR2.
Sequence:SFLLRN
MW:748.9 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C
Catalog Number: 102996-470
Supplier: Anaspec Inc
Image Unavailable-103008-566

LKBtide Peptide

Description: This is a peptide substrate that is phosphorylated by Serine/Threonine kinase 11 (STK11), also known as LKB1. LKBtide is derived from sucrose non-fermenting 1 (SNF1) protein kinase, which is normally activated by the LKB1/AMP-activated protein kinase (AMPK) signaling pathway.
Sequence:LSNLYHQGKFLQTFCGSPLYRRR
MW:2785.2 Da
% peak area by HPLC:95
Storage condition:-20° C
Catalog Number: 103008-566
Supplier: Anaspec Inc
Product Image-82021-512

Molecular biology kit universal

Description: Molecular biology universal kit, contains 25 ml each of ammonium acetate, calcium chloride, EDTA, lithium acetate, magnesium chloride, potassium acetate, potassium chloride, SDS, sodium chloride, TE, Tris pH 7,0 and Tris pH 8,0
Catalog Number: 82021-512
Supplier: G-Biosciences
Image Unavailable-103006-412

(Arg)9, FAM (Carboxyfluorescein), AnaSpec

Description: (Arg)9 is a cell-permeable peptide used for drug delivery.It can traverse the plasma membrane of eukaryotic cells. This is a fluorescent (FAM)-labeled cell permeable peptide, Abs/Em = 494/521 nm.
Sequence:FAM-RRRRRRRRR
MW:1782 Da
% peak area by HPLC:95
Storage condition:-20° C
Catalog Number: 103006-412
Supplier: Anaspec Inc
Image Unavailable-103815-252

Cynomolgus Monkey, Rhesus macaque Recombinant FcRn (FCGRT & B2M) (from HEK293 cells), Biotin

Description: Biotinylated Cynomolgus / Rhesus macaque FcRn / FCGRT&B2M Heterodimer Protein, His,Avitag™ (SPR verified), ACROBiosystems
Catalog Number: 103815-252
Supplier: ACROBIOSYSTEMS
Image Unavailable-103008-218

Chicken OVA (241-270)

Description: This peptide is OVA peptide residues 241 to 270. OVA Peptide is a class I (Kb)-restricted peptide epitope of ovalbumin presented by the class I MHC (major histocompatibility complex) molecule, H-2Kb (class I genes of the mouse MHC).
Sequence: SMLVLLPDEVSGLEQLESIINFEKLTEWTS
MW: 3421.9 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C
Catalog Number: 103008-218
Supplier: Anaspec Inc
Image Unavailable-103007-188

MBP (68–86)

Description: This peptide corresponds to the myelin basic protein (MBP) encephalitogenic epitope used to induce experimental autoimmune encephalomyelitis (EAE) in rats. It corresponds to amino acids 69-85 from guinea pig MBP.
Sequence:YGSLPQKSQRSQDENPV
MW:1933.1 Da
% peak area by HPLC:95
Storage condition:-20° C
Catalog Number: 103007-188
Supplier: Anaspec Inc
Image Unavailable-103008-532

Histone H4 (1-23)-GSGSK, Biotin

Description: This peptide consists of amino acids 1-23 of histone H4 attached at the C-terminal by a GSGS linker to biotinylated lysine. It is used as a substrate for histone acetyltransferase (HAT) assays. Biotinylation allows the peptide to be captured on streptavidin or agarose beads.
Sequence:SGRGKGGKGLGKGGAKRHRKVLR-GSGSK(Biotin)
MW:3003.6 Da
% peak area by HPLC:95
Storage condition:-20° C
Catalog Number: 103008-532
Supplier: Anaspec Inc
Image Unavailable-103007-760

SV-40 Large T-Antigen Nuclear Localization Signal

Description: This peptide is derived from Large T antigen residue 47 to 55 (PKKKRKVED). It is a commonly used nuclear localization signal (NLS) peptide. It enables protein import into cell nucleus.
Sequence:CGGGPKKKRKVED
MW:1401.7 Da
% peak area by HPLC:95
Storage condition:-20° C
Catalog Number: 103007-760
Supplier: Anaspec Inc
Image Unavailable-103008-438

Chicken OVA (323-339), FITC (Fluorescein Isothiocyanate)

Description: This fluorescent (FITC)-labeled OVA (323 - 339) Peptide is an H-2b-restricted OVA class II epitope (Abs/Em = 493/522 nm).
Sequence: FITC-LC-ISQAVHAAHAEINEAGR
MW: 2276.5 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C
Catalog Number: 103008-438
Supplier: Anaspec Inc
Image Unavailable-103007-452

43Gap 26, Connexin Mimetic

Description: This Gap 26 peptide is derived from the first extracellular loop sequence of connexin (Cx) 43. This short mimetic peptide reversibly inhibits the gap junction-dependent propagation of Ca2+ waves between tracheal airway epithelial cells.
Sequence:VCYDKSFPISHVR
MW:1550.8 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C
Catalog Number: 103007-452
Supplier: Anaspec Inc
Image Unavailable-103815-494

Human Recombinant PD-1 (from HEK293 Cells)

Description: Human PD-1 / PDCD1 Protein, His Tag, low endotoxin (MALS verified), ACROBiosystems
Catalog Number: 103815-494
Supplier: ACROBIOSYSTEMS
1 - 16 of 377,137