You Searched For: GENERAL SEPARATION TECHNOLOGIES

Description: QXL® 570 dyes are optimized quenchers for rhodamines (such as TAMRA, sulforhodamine B, ROX) and Cy3 fluorophores.

Catalog Number: 103011-070

Supplier: Anaspec Inc

Sale

Description: This peptide is a nuclear receptor (NR) box B3 region of the p160 co-activator Transcriptional Intermediary Factor 2 (TIF2) peptide, a LXXLL motif. The activation function 2/ligand-dependent interaction between nuclear receptors and their co-regulators is mediated by a short consensus motif nuclear receptor box.
Sequence:KENALLRYLLDKDD
MW:1705.9 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: 103007-134

Supplier: Anaspec Inc

Sale

Description: The sequence (Accession # NP_001116849) corresponding to the full length human DJ-1 protein along with N-terminal GST tag was expressed in E. coli. The recombinant DJ-1 protein was purified from bacterial lysate using GST affinity chromatography followed by GST tag cleavage and removal. The molecular weight of the recombinant DJ-1 protein is 19.9 kDa.
DJ-1 is also known as PARK7 (Parkinson disease protein 7). It is a 189-amino acid protein that is ubiquitously expressed in many organs including brain, liver, kidney, pancreas, heart, and others. Although DJ-1 was originally discovered as a novel oncogene product, it was found to play several other roles in biological processes. This includes the regulation of RNA binding activity, fertility, anti-oxidative stress, and is linked to the early onset of Parkinson disease when mutated. Sequence (Accession# NP_001116849) corresponds to the full length human DJ-1 protein and was expressed in E. coli.

Catalog Number: 103010-648

Supplier: Anaspec Inc

Sale

Description: This kit contains 6 individually-packed phosphopeptides at 10 ug each. These phosphopeptides can be used for the characterization of affinity purified phosphorylated peptides in liquid chromatography / mass spectrometry. FQ-pS-EEQQQTEDELQDK MW: 2062.0 (Bovine ß-Casein, monophospho cat# 61146, $120/mg) DLDVPIPGRFDRRV-pS-VAAE MW: 2192.4 (PKA Regulatory Subunit II Substrate, cat# 24516, $295/mg) KRP-pS-QRHGSKY-NH2 MW: 1422.5 (UOM9, Phosphorylated PKC Substrate-3, cat# 20294, $175/mg) SFVLNPTNIGM-pS-KSSQGHVTK MW: 2312.6 (DAM1 [221-241] peptide, cat# 61242, $180/mg) TRDIYETDpYYRK MW: 1702.8 (Kinase Domain of Insulin Receptor, cat# 20274 $195/mg) TRDIpYETDpYpYRK MW: 1862.8 (Kinase Domain of Insulin Receptor, cat# 20272 $240/mg)
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: 103006-362

Supplier: Anaspec Inc

Sale

Description: This peptide is Histone H3 amino acid residues 1 to 21 tri-methylated at Lys-9 with a C-terminal GG linker followed by a biotinylated lysine. Provided at >95% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.
Sequence:ARTKQTAR-K(Me3)-STGGKAPRKQLA-GGK(Biotin)
MW:2765.2 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: 103007-982

Supplier: Anaspec Inc

Sale

Description: Spectra of HiLyte™ Fluor 647 conjugates are slightly red-shifted compared to those of Cy5 dyes, resulting in an optimal match to filters designed for Cy5 dyes.

Catalog Number: 103010-190

Supplier: Anaspec Inc

Sale

Description: MMP-7 (matrilysin, PUMP) is involved in biological events, such as tissue remodeling, cell proliferation and host defenses.

Catalog Number: 103010-236

Supplier: Anaspec Inc

Sale

Description: This is histone H3 (1-21) symmetrically dimethylated at Arg8 with a methyl group added to each nitrogen of the guanidinium group. This peptide is biotinylated at the epsilon side chain of an additional C-terminal Lys. Methylation at Arg8 blocks G9a methylation of Lys9. Provided at >95% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.
Sequence:ARTKQTA-R(Me2s)-KSTGGKAPRKQLA-K(Biotin)
MW:2637.1 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: 103009-906

Supplier: Anaspec Inc

Sale

Description: This is a hypoxia-inducible factor-1 (HIF-1 a) 19-mer fragment. HIF-1 functions as master regulator of response to oxygen homeostasis. Hypoxia-induced gene expression is initiated when HIF-1 subunit is stabilized in response to a lack of oxygen. This part of HIF-1 binds to the von Hippel-Lindau factor (VHL) an E3 ubiquitin ligase, and the proline 564 is absolutely critical to the binding process
Sequence:DLDLEMLAPYIPMDDDFQL
MW:2254.6 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: 103006-808

Supplier: Anaspec Inc

Sale

Description: Matrix Metalloproteinases (MMPs) are a large family of endopeptidases. Collectively, MMPs can degrade all kinds of extracellular matrix proteins, and can also process a number of bioactive molecules. They are known to be involved in the cleavage of cell surface receptors, the release of apoptotic ligands, and chemokine/cytokine inactivation. MMPs are also thought to play a major role in cell behaviors such as cell proliferation, migration (adhesion/dispersion), differentiation, angiogenesis, apoptosis, and host defense.
This peptide is a sensitive substrate for assaying MMP-3 and 12 activities, Abs/Em = 494/521nm.
Sequence:5-FAM-RPKPVE-Nva-WRK(QXL™ 520)-NH2
MW:2143.3 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: 103005-940

Supplier: Anaspec Inc

Sale

Description: This peptide is histone H4, amino acids 1 to 21. It is acetylated at Lys-8 and at the N-terminus with a C-terminus GG linker, followed by a biotinylated lysine. The acetylation of histone H4 causes structural changes that amplify the binding of transcription factors to their recognition sites within the nucleosome.
Sequence:Ac-SGRGKGG-K(Ac)-GLGKGGAKRHRKV-GGK(Biotin)
MW:2644.1 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: 103006-536

Supplier: Anaspec Inc

Sale

Description: This b-amyloid (1-42) contains the Tottori-Japanese (D7N) mutation where Asp7 is replaced by Asn7. In vitro analysis using beta-amyloid 1 to 40-based mutant peptide reveals that the D7N mutation does not accelerate the nucleation phase but selectively promotes the elongation phase of amyloid fibril formation. The levels of protofibrils generated from D7N beta-amyloid were markedly inhibited despite enhanced fibril formation.
Sequence: DAEFRHNSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
MW: 4513.1 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Catalog Number: 103007-608

Supplier: Anaspec Inc

Sale

Description: This peptide is histone H4 (1-25) with acetylation at Lys16. It is biotinylated through a C-terminal GSGSK linker. Monoacetylation of histone H4 occurs predominantly at Lys16. Loss of monoacetylation at Lys16 is associated with human tumor cells. Provided at >95% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.
Sequence:SGRGKGGKGLGKGGA-K(Ac)-RHRKVLRDN-GSGSK(Biotin)
MW:3274.8 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: 103009-050

Supplier: Anaspec Inc

Sale

Description: This peptide corresponds to amino acids 26 to 46 of human histone H3. It is dimethylated at lysine-36, followed by a biotinylated lysine. The methylation of histone H3 at lysine 36 (K36) has recently been shown to be associated with RNA polymerase II (Pol
Sequence:RKAAPATGGV-K(Me2)-KPHRYRPGTV-K(Biotin)
MW:2630.1 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: 103008-276

Supplier: Anaspec Inc

Sale

Description: These sequences correspond to the tyrosine phosphorylation site of the Rous sarcoma virus-encoded transforming protein pp60 SRC.
Sequence:RRLIEDNE-pY-TARG
MW:1672.7 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: 102996-272

Supplier: Anaspec Inc

Sale

Description: This peptide is derived from Histone H3 21-44 amino acids, with additional glycine and lysine at the C-terminus with lysine biotinylated and used as substrate in methylation assays.
Sequence:ATKAARKSAPATGGVKKPHRYRPG-GK(Biotin)
MW:2917.5 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: 103008-158

Supplier: Anaspec Inc

Sale