Print…

You Searched For: PERKINELMER U.S. LLC


485,990  results were found

Refine Results Sort by

Sort Results

List View Easy View (new)
SearchResultCount:"485990"

Rate These Search Results

Image Unavailable-103007-614

Beta-Amyloid (1-40)-Lys(Biotin)-NH2 0.1 mg

Description: Beta-Amyloid (1-40)-Lys(Biotin)-NH2, mouse, rat, Sequence: DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVV-K(Biotin)-NH2, Purity: By HPLC >/= 95%, labeled on the N-terminus with HiLyte* Fluor 647, Abs/Em = 649/674 nm, Molecular Weight: 5449.4, Size: 0.1 mg
Catalog Number: 103007-614
Supplier: Anaspec Inc
Image Unavailable-103003-804

Beta-Amyloid Peptide (1-42) 1 mg

Description: Beta-Amyloid Peptide (1-42), mouse, rat, Purity: HPLC >/- 95%, Molecular Weight: 4418, Sequence: DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIA, Appearance: Lyophilized white powder, Storage: -20 deg C, Size: 1 mg
Catalog Number: 103003-804
Supplier: Anaspec Inc
Image Unavailable-BDH3046-2.5L

BDH* Nitric Acid 70% ACS 2.5 L

Description: BDH* Nitric Acid, ACS, Purity: 70%, CAS 7697-37-2, Molecular Formula: HNO, Molecular weight: 63.01, density 1.42 kg/L, 2.5L poly coated glass, Size: 2.5 L
Catalog Number: BDH3046-2.5L
Supplier: BDH

SDS Certificates


Image Unavailable-102996-540

Endothelin 3 1 mg

Description: Endothelin 3, human, rat, Purity: HPLC >/= 95%, Molecular Weight: 2643.1, Sequence: CTCFTYKDKECVYYCHLDIIW, Appearance: Lyophilized white powder, is a member of a family of potent vasoconstrictors namely, Endothelin and Sarafotoxin, Storage: -20 deg C, Size: 1 mg
Catalog Number: 102996-540
Supplier: Anaspec Inc
Image Unavailable-103007-480

Deltorphin B 1 mg

Description: Deltorphin B, Sequence: YaFEVVG-NH2, Purity: By HPLC greater than or equal to 95%, Deltorphin B (or Deltorphin II) was first isolated from the skin of Phyllomedusa bicolor, Molecular Weight: 782.9, Storage: -20 deg C, Size: 1 mg
Catalog Number: 103007-480
Supplier: Anaspec Inc
Image Unavailable-103007-228

epsilon-V1-2, epsilon-PKC Inhibitor, Cys-conjugated 1 mg

Description: epsilon-V1-2, epsilon-PKC Inhibitor, Cys-conjugated, Sequence: EAVSLKPTC, Purity: HPLC >/= 95%, inhibitory activity is based on EPKC translocation and MARCKS phosphorylation, Molecular Weight: 947.1, Storage: -20 C, Size: 1 mg
Catalog Number: 103007-228
Supplier: Anaspec Inc
Image Unavailable-103007-586

Enterokinase Substrate 1 mg

Description: Enterokinase Substrate, Sequence: GDDDDK-BNA, Purity: By HPLC greater than or equal to 95%, This peptide is an enterokinase substrate also known as enteropeptidase, Molecular Weight: 788.8, Apperance: Powder, Storage: -20 deg C, Size: 1 mg
Catalog Number: 103007-586
Supplier: Anaspec Inc
Image Unavailable-103007-236

Proapoptotic Peptide, (klaklak)2 1 mg

Description: Proapoptotic Peptide, (klaklak)2, Sequence: klaklakklaklak - NH2, Purity: HPLC >/= 95%, Molecular Weight: 1523, Apperance: Lyophilized white powder, Peptide Reconstitution: Proapoptotic peptide is freely soluble in water, Storage: -20 deg C, Size: 1 mg
Catalog Number: 103007-236
Supplier: Anaspec Inc
Image Unavailable-102996-538

Endothelin 3 0.5 mg

Description: Endothelin 3, human, rat, Purity: HPLC >/= 95%, Molecular Weight: 2643.1, Sequence: CTCFTYKDKECVYYCHLDIIW, Appearance: Lyophilized white powder, is a member of a family of potent vasoconstrictors namely, Endothelin and Sarafotoxin, Storage: -20 deg C, Size: 0.5 mg
Catalog Number: 102996-538
Supplier: Anaspec Inc
Image Unavailable-103007-764

Staphylococcal Enterotoxin B Domain (SEB) (144-153) 1 mg

Description: Staphylococcal Enterotoxin B Domain (SEB) (144-153), Sequence: KKKVTAQELD, Purity: By HPLC >/= 95%, peptide is Staphylococcal Enterotoxin B domain (SEB) amino acid residue 163-172, Molecular Weight: 1159.4, Storage: -20 deg C, Size: 1 mg
Catalog Number: 103007-764
Supplier: Anaspec Inc
Image Unavailable-103008-590

Autocamtide-3 Derived Inhibitory Peptide(AC3-I) CaMKII Inhibitor 1mg

Description: Autocamtide-3 Derived Inhibitory Peptide(AC3-I); CaMKII Inhibitor, myristoylated, Purity: Greater than or equal to 95% (HPLC), Molecular weight: 1689.1, Sequence: Myr-KKALHRQEAVDAL, Storage: -20 degree C, Size: 1mg
Catalog Number: 103008-590
Supplier: Anaspec Inc
Image Unavailable-103007-230

Psi - RACK, epsilon - C2/V1 (82 - 92), epsilon PKC (82 - 92), C2 Domain 1 mg

Description: Psi - RACK, epsilon - C2/V1 (82 - 92), epsilon PKC (82 - 92), C2 Domain, Sequence: HDAPIGYD, Purity: HPLC >/= 95%, e-PKC specific activator, it also activates MARCKS phosphorylation, Molecular Weight: 886.9, Size: 1 mg
Catalog Number: 103007-230
Supplier: Anaspec Inc
Image Unavailable-103007-400

OVA (257-264), amide 5 mg

Description: OVA (257-264), amide, Sequence: SIINFEKL-NH2, Purity: By HPLC >/= 95%, octameric peptide is amino acids 257 to 264 amidated fragment of ovalbumin (OVA), a class I (Kb)-restricted peptide epitope of OVA, Molecular Weight: 962.2, Storage: -20 deg C, Size: 5 mg
Catalog Number: 103007-400
Supplier: Anaspec Inc
Image Unavailable-103009-696

[Arg(Me2s)3] - Histone H4 (1-21)

Description: [Arg(Me2s)3] - Histone H4 (1-21) - GGK(Biotin); H4R3(Me2s) (1-21), Purity: HPLC >/= 95%, Molecular weight: 2630.1, Sequence One-Letter Code/Three-Letter Code: [Ac-SG-R(me2s)-GKGGKGLGKGGAKRHRKV-GGK(biotin)] Store: -20 deg C, Size: 1mg
Catalog Number: 103009-696
Supplier: Anaspec Inc
Image Unavailable-103007-638

[Cys26]-beta-Amyloid (1-42) S26C beta-Amyloid (1-42) 0.5 mg

Description: [Cys26]-beta-Amyloid (1-42), S26C beta-Amyloid (1-42), Human, Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGCNKGAIIGLMVGGVVIA, Purity: By HPLC >/= 95%, Molecular Weight: 4530.2, Apperance: Lyophilized white powder, Storage: -20 C, Size: 0.5 mg
Catalog Number: 103007-638
Supplier: Anaspec Inc
Image Unavailable-103014-870

Human LBP /Lipopolysaccharide Protein

Description: LBP /Lipopolysaccharide Protein, Host: HEK293 Cells, Species Reactivity: Human, purity: >95%, Molecular Characterization: MW of 52.8 kDa, Synonym: Lambda Chain Binding Protein,Lambda Binding Protein,LBP, Storage: 4 deg C, Size: 100UG
Catalog Number: 103014-870
Supplier: ACROBIOSYSTEMS
513 - 528 of 485,990