You Searched For: Alloys and Metal Ore Standards

Description: This is biotinylated Protein A conjugate suitable for asssay development, IHC, IF, immunoprecipitation or western blotting.
AnaSpec's recombinant Protein A consists of only IgG binding domains and was expressed using a recombinant bacterial expression system. Its apparent molecular weight is approximately 30,000 Da compared to 42,000 Da for the native Protein A that is found in Staphylococcus aureus.
Protein A conjugates are widely used as labeled reagents for a variety of experiments including immunoprecipitation, antibody detection and purification and assay development

Catalog Number: 103010-690

Supplier: Anaspec Inc

Sale

Description: α-CGRP is preferentially expressed in sensory neuron. Both alpha-CGRP and beta-CGRP increase the rate and force of atrial contractions.
Sequence:SCNTATCVTHRLAGLLSRSGGVVKDNFVPTNVGSEAF-NH2 (Disulfide bridge: 2-7)
MW:3806.3 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Catalog Number: 103003-360

Supplier: Anaspec Inc

Sale

Description: Pep-1 is one of the synthetic cell-penetrating peptides (CPPs), which has been successfully used to deliver a variety of proteins and other biopharmaceutical macromolecules into cells in a non-disruptive way. It is a CPP with primary amphipathicity (i.e amphipathicity resulting from the amino acid sequence itself, not from the folding structure) that comprises a tryptophan-rich so-called ‘hydrophobic’ domain, a hydrophilic domain derived from an NLS (nuclear localization signal) of SV40 (simian virus 40) large T-antigen, and a spacer between them. A cysteamine group is present at the C-terminus. The presence of cysteamine group in C terminal seems to play a crucial role in the delivery efficiency of cargoes into cells.
Sequence:Ac-KETWWETWWTEWSQPKKKRKV-cysteamine
MW:2950.3 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: 103007-778

Supplier: Anaspec Inc

Sale

Description: This octapeptide is a COOH-terminal fragment of the C3a anaphylatoxin peptide. On a molar basis, this peptide possesses 1-2% of the biological activities of C3a. It causes contraction of rodent ileum and uterus, release of vasoactive amines from rat mast cells, and increases vascular permeability in guinea pig and human skin. Both purified C3a and synthetic C3a (70-77), which retains partially the activity of anaphylatoxin, are shown to interact directly with human lymphocytes.
Sequence:ASHLGLAR
MW:823.9 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: 103006-356

Supplier: Anaspec Inc

Sale

Description: Nicotinamide nucleotides are key players in the energy transforming and oxidation-reduction reactions of a cell

Catalog Number: 103010-618

Supplier: Anaspec Inc

Sale

Description: AnaSpec's AggreSure™ beta-Amyloid (1-40) peptide is pretreated and tested for aggregation using AnaSpec's SensoLyte® ThT Aβ40 Aggregation kit (Cat# AS-72213).
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Molecular Weight: 4329.9 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Catalog Number: 103010-638

Supplier: Anaspec Inc

Sale

Description: This SensoLyte® high-sensitivity (2pg/mL) beta-Amyloid (1-42) Quantitative ELISA Kit (Mouse/Rat) provides a convenient and quantitative assay for determining mouse/rat beta-Amyloid (1-42) (Aβ42) amount in cell and tissue lysate as well as in body fluids

Catalog Number: 103001-640

Supplier: Anaspec Inc

Sale

Description: Myelin Oligodendrocyte Glycoprotein (MOG) is a member of the immunoglobulin superfamily and is expressed exclusively in the central nervous system (CNS). Although MOG protein constitutes only 0.01-0.05% of the CNS myelin proteins, it was demonstrated that MOG protein is a crucial autoantigen for multiple sclerosis in humans and experimental autoimmune encephalomyelitis (EAE) in rodents and monkeys

The sequence (Accession # CAQ10087) corresponding to the extracellular domain of human MOG along with a 6x His tag was expressed in E. coli. The recombinant human MOG (H-rMOG) was purified from urea denatured bacterial lysate using immobilized metal affinity chromatography (IMAC). The molecular mass of the recombinant human MOG is 14.2 kDa

Catalog Number: 102998-096

Supplier: Anaspec Inc

Sale

Description: This is peptide substrate for many protein kinases, such as Blk, BTK, cKit, EPHA1, EPHB2, EPHB3, ERBB4, FAK, Flt3, IGF-1R, ITK, Lck, MET, MUSK, Ret, Src, TIE2, TrkB, VEGF-R1 (Flt-1) and VEGF-R2 (KDR).
Sequence:GEEPLYWSFPAKKK-NH2
MW:1678 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: 103007-838

Supplier: Anaspec Inc

Sale

Description: Although FITC reagents have been more often used to prepare fluoresceinated bioconjugates, the low stability of FITC bioconjugates makes some researchers use amine-reactive succinimidyl esters of carboxyfluorescein (commonly called FAM) in bioconjugations. FAM reagents give carboxamides that are more resistant to hydrolysis. We have shown that FAM reagents require less stringent reaction conditions and give better conjugation yields, and the resulted conjugates have superior stability. We noted that FITC labeled peptides tend to deteriorate more quickly than the corresponding FAM conjugates.

Catalog Number: 103010-748

Supplier: Anaspec Inc

Sale

Description: This peptide corresponds to the myelin basic protein (MBP) encephalitogenic epitope used to induce experimental autoimmune encephalomyelitis (EAE) in rats. It corresponds to amino acids 69-85 from guinea pig MBP.
Sequence:YGSLPQKSQRSQDENPV
MW:1933.1 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: 103007-188

Supplier: Anaspec Inc

Sale

Description: West Nile virus (WNV) is a member of the flavivirus genus, which contains many significant human pathogens including Dengue virus (Den), Japanese Encephalitits virus (JE), and Yellow Fever virus (YF). WNV is a small, enveloped virus with a single stranded, positive sense 11kb RNA genome, which encodes a polyprotein precursor. This polyprotein must be cleaved co- and post-translationally to produce ten functional proteins: three structural (C, prM and E) and 7 nonstructural (NS1, NS2A, NS2B, NS3, NS4A,NS4B and NS5). WNV NS3 protease is absolutely essential (along with viral-encoded cofactor NS2B) for post-translational cleavage and viral replication. As a result, this protease is a potential therapeutic target.

His-tagged recombinant WNV NS3 protease (residues 1 to 184) was expressed as a fusion protein with the cofactor NS2b (residues 49 to 96) and a linker sequence (GGGGSGGGG) in E. coli. The apparent Mr on SDS-PAGE is 32-kDa. Its activity can be measured by FRET peptides

Catalog Number: 103010-402

Supplier: Anaspec Inc

Sale

Description: Kisspeptin was originally identified as a human metastasis suppressor gene that has the ability to suppress melanoma and breast cancer metastasis. Kisspeptin-GPR54 signaling has an important role in initiating secretion of gonadotropin-releasing hormone (GnRH) at puberty from the anterior pituitary.
This amidated peptide sequence is found in C-terminal residues 110 to 119 of the neurohormone Metastin (also referred to as Kisspeptin-10); it increases plasma concentrations of GH (Growth Hormone) and LH (Luteinizing Hormone).
Sequence:YNWNSFGLRY-NH2
MW:1318.5 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: 103008-422

Supplier: Anaspec Inc

Sale

Description: This is a biotinylated fragment of the human, mouse, rat ß-amyloid (15-25).
Sequence: Biotin-LC-QKLVFFAEDVG
Molecular Weight: 1591.9 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Catalog Number: 103007-546

Supplier: Anaspec Inc

Sale

Description: Unlike FDG that requires a two-step hydrolysis to generate maximum fluorescence, resorufin β-D-galactopyranoside requires only a single-step hydrolysis reaction to attain full fluorescence. This substrate is especially useful for sensitive enzyme measurements in ELISAs. The relatively low pKa (~6.0) of resorufin (the enzymatic hydrolysis product of resorufin galactoside) with Ex/Em=573/585 nm permits continuous measurement of enzymatic activity. Resorufin galactoside has also been used to quantitate β-galactosidase activity in single yeast cells by flow cytometry and to detect immobilized β-galactosidase activity.

Catalog Number: 103011-314

Supplier: Anaspec Inc

Sale

Description: Galanin, a 29 or 30 (in human) amino acid neuropeptide, is found in the central and peripheral nervous systems and displays several important physiological activities. These actions are mediated through distinct G protein-coupled receptors. It has been involved in food behavior, regulation of sleep and mood, control of blood pression and nociception, among others.
Sequence:GWTLNSAGYLLGPHAVGNHRSFSDKNGLTS
MW:3157.5 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: 103003-398

Supplier: Anaspec Inc

Sale