You Searched For: Dichloroacetic acid (DCA)

Description: Calcitonin, salmon, disulfide bridge between Cys1 and Cys7, Purity: % Peak Area By HPLC >/=95%, Molecular Weight: 3431.9, Sequence (One-Letter Code): CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP-NH2 (Disulfide bridge: 1-7),Physical State Powder, Storage -20 deg C, Size: 5mg

Catalog Number: 102998-454

Supplier: Anaspec Inc

Sale

Description: Epstein - Barr Virus (EBV) Control Peptide Pool, have been used in the stimulation of IFNgamma release from CD8+ T cells in individuals with defined HLA types, Storage: -20 deg C, Size: 3.75 mg

Catalog Number: 103007-300

Supplier: Anaspec Inc

Sale

Description: VEGFR2/KDR Antagonist, Purity: HPLC >/- 95%, Molecular Weight: 840, Sequence: H-Ala-Thr-Trp-Leu-Pro-Pro-Arg-OH, Appearance: Powder, This peptide is a specific VEGFR2/KDR heptapeptide antagonist, it binds VEGFR2 (KDR/flk), Storage: -20 deg C, Size: 1 mg

Catalog Number: 103003-280

Supplier: Anaspec Inc

Sale

Description: PA (224-233), Influenza murine H-2 Db- and Kb-restricted immunodominant CTL epitope of influenza PR8 virus, Purity: HPLC greater than or equal to 95%, Sequence (One-Letter Code): SSLENFRAYV, Molecular Weight: 1185.3, Storage: -20 degree C, Size: 1 mg

Catalog Number: 103006-884

Supplier: Anaspec Inc

Sale

Description: [Lys(Ac)9/14]-Histone H3 (1-21)-GGK(Biotin), H3K9/14(Ac), biotin-labeled, Sequence: ARTKQTAR-K(Ac)-STGG-K(Ac)-APRKQLA-GGK(Biotin), Purity: By HPLC >/= 95%, Histone H3 amino acid residues 1 to 21 acetylated, Molecular Weight: 2807.3, Size: 1 mg

Catalog Number: 103007-994

Supplier: Anaspec Inc

Sale

Description: [Lys(Ac)9]-Histone H3 (1-20), H3K9(Ac), Sequence: ARTKQTAR-K(Ac)-STGGKAPRKQL, Purity: By HPLC >/= 95%, Histone H3 acetylated at lysine 9, play an important role in chromatin-directed gene transcription, Molecular Weight: 2225.6, Storage: -20 C, Size: 1 mg

Catalog Number: 103007-654

Supplier: Anaspec Inc

Sale

Description: Recombinant Human Tau (Tau-441) Protein, Source: E. Coli, Purity: Greater than 90% as determined by SDS-PAGE, GSK-3B kinase assay, 45.8 kDa, Application: In vitro phosphorylation, Western Immunoblotting and ELISA standard, Storage: 2-4 degree C, Size: 50ug

Catalog Number: 103001-650

Supplier: Anaspec Inc

Sale

Description: Biotin - Bradykinin, Sequence: Biotin - RPPGFSPFR, Purity: HPLC greater than or equal to 95%, Molecular Weight: 1286.5, Apperance: Lyophilized white powder, Peptide Reconstitution: Biotin-Bradykinin is freely soluble in water, Storage: -20 deg C, Size: 1 mg

Catalog Number: 102999-768

Supplier: Anaspec Inc

Sale

Description: H-Ala-Pro-AFC, Purity: HPLC >/= to 95%, Molecular Weight: 397.2, Sequence: AP-AFC, Appearance: powder, This is a fluorescent peptide, Storage: -20 deg C, Size: 10 mg

Catalog Number: 102996-438

Supplier: Anaspec Inc

Sale

Description: Bac2A; Bactenecin 2A, Purity: Greater than or equal to 95% (HPLC), Molecular weight: 1420.8, Sequence: RLARIVVIRVAR-NH2, peptide a linear variant of loop-shaped cationic antimicrobial peptide Bactenecin found in bovine neutrophils, Storage: -20 degree C, Size: 1mg

Catalog Number: 103008-584

Supplier: Anaspec Inc

Sale

Description: 5-FAM, single isomer, Synonym: 5-Carboxyfluorescein, Molecular Weight: 376.32, Molecular Formula: C21H12O7, Appearance: Orange solid, Purity: >95% (TLC), >95% (HPLC), Spectral Properties Abs/Em = 492/518 nm, Solvent System DMF or DMSO, Storage: -20 deg C desiccated, Size: 100 mg

Catalog Number: 103010-754

Supplier: Anaspec Inc

Sale

Description: 6-ROX, SE, CAS: 216699-36-4, 6-Carboxy-X-rhodamine, succinimidyl ester; 6-ROX, NHS ester, Purity: greater than or equal to 90% by HPLC, purified single isomer, for labeling peptides/proteins, sequencing nucleic acids, MW: 631.67, Spectral Properties: Abs/Em = 575/602 nm, Size: 5 mg

Catalog Number: 103010-824

Supplier: Anaspec Inc

Sale

Description: Beta - Amyloid (2 - 42), Human, Purity: Peak Area By HPLC Greater than or equal to 95%, Molecular Weight: 4399, Sequence: AEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA, Appearance: Lyophilized white powder, Storage: -20 degree C, Size: 0.1 mg

Catalog Number: 103000-894

Supplier: Anaspec Inc

Sale

Description: H-D-Val-Leu-Arg-AFC, Purity: HPLC >/= 95%, Molecular Weight: 597.5, Sequence: vLR-AFC, Appearance: Powder, This is a fluorescent glandular kallikrein substrate, Abs/Em=380/500 nm, Storage: -20 deg C, Size: 10 mg

Catalog Number: 102996-446

Supplier: Anaspec Inc

Sale

Description: GIP (3-42), human, potent antagonist as opposed to the agonist full length GIP on the GIP receptor, Purity: HPLC >/= 95%, Sequence (One-Letter Code): EGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ, MW: 4759.4, Appearance: Lyophilized white powder, Storage: -20 degree C, Size: 5 mg

Catalog Number: 103006-440

Supplier: Anaspec Inc

Sale

Description: Biotin - LC - MBP Derivatized Peptide, Purity: Peak Area By HPLC >/= 95%, Molecular Weight 2252.7, Sequence (One-Letter Code): Biotin-LC-FFKNIVTPRTPPPSQGK-NH2, Physical State: Solid, Storage: -20 deg C Store away from oxidizing agent, Size: 1 mg

Catalog Number: 103004-118

Supplier: Anaspec Inc

Sale