You Searched For: stab2


0  results were found

Sort Results

List View Easy View (new)
SearchResultCount:"0"
Description: GTPBP3, Polyclonal Antibody, Host: Mouse, Species Reactivity: Human, rat, Isotype: IgG, Immunogen: GTPBP3 (NP-116009.1, 1 a.a. - 492 a.a) full-length human Protein, Purity: Protein G purified, Application: WB, ELISA, Storage: -20C or -80C, Size: 0.05mg
Catalog Number: 103345-354
Supplier: Novus Biologicals


Description: GTPBP3 Polyclonal Antibody, Host: Rabbit, Species: Human, Isotype: Ig, Immunogen: KLH conjugated synthetic peptide between 293-320 amino acids from the Central region, Synonym: Mitochondrial GTP-binding protein 1, GTPBP3, MTGP1, Application: WB, Size: 400ul
Catalog Number: 76065-584
Supplier: Prosci


Description: GTPBP3, Polyclonal antibody, Host: Rabbit, Isotype: IgG, Species reactivity: Human, Mouse, Rat, Immunogen: HALRILTAPRDLPLARHASLRLLSDPRSGEPLDRALVLWFPGPQSFTGEDCVEFHVHGGPAVVSGVLQALGSVPGLRPAEAGEFTRRAFANGKLNL, Application: WB, ICC/IF, IHC, IHC-P, Size: 100UL
Catalog Number: 103276-930
Supplier: Novus Biologicals


Catalog Number: 76866-026
Supplier: ANTIBODIES.COM LLC


Description: STXBP4 monoclonal antibody (M03), clone 2B12, Mouse monoclonal antibody raised against a full-length recombinant STXBP4, Size: 100ug
Catalog Number: 10602-904
Supplier: Abnova


Description: Rabbit Polyclonal antibody to ATBP3 (cytosolic thiouridylase subunit 1 homolog (S. pombe)) Purity: Immunoge affinity-chromatography. Species Reactivity: Human Tested Applications: ELISA WB Pkg Size: 100 ug
Catalog Number: 89290-086
Supplier: Genetex


Catalog Number: 77724-034
Supplier: AFG BIOSCIENCE LLC

New Product


Description: STRBP, Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Rat, Isotype: Igg, Immunogen: This antibody was developed against Recombinant Protein, Synonyms: spermatid perinuclear RNA-binding protein, SPNRFLJ21960, Applications: IHC, IHC-P, Size: 100ul
Catalog Number: 103259-326
Supplier: Novus Biologicals


Description: Rabbit Polyclonal antibody to SSBP3 (single stranded DNA binding protein 3) Purity: Peptide Affinity Purified Species Reactivity: Human Mouse Rat Tested Applications: WB Pkg Size: 50 ug
Catalog Number: 89267-048
Supplier: Genetex


Catalog Number: 77797-685
Supplier: AFG BIOSCIENCE LLC

New Product


Description: STRBP polyclonal antibody, Rabbit polyclonal antibody raised against recombinant STRBP, Size: 100 uL
Catalog Number: 10739-934
Supplier: Abnova


Description: Purity: Purified by antigen-affinity chromatography. Species Reactivity: Human, Mouse Tested Applications: IHC-P, WB Pkg Size: 100 ul
Catalog Number: 89321-870
Supplier: Genetex


Description: STXBP1 / UNC18A Protein (His & GST Tag) Recombinant, Purity: > 85 % as determined by SDS-PAGE, Host: Baculovirus-Insect Cells, Species: Human, Immunogen: consists of 831 amino acids and has a calculated molecular mass of 95.4 kDa, size: 100ug
Catalog Number: 103622-772
Supplier: Sino Biological


Description: AMISYN Polyclonal Antibody, Host: Rabbit, HRP Conjugated, Species: Human, Mouse, Rat, Isotype: IgG, Synonymns: Amisyn; HSPC156; STXB6_HUMAN; STXBP6, Application: IHC-P, IF(IHC-P), 100ul
Catalog Number: 10247-164
Supplier: Bioss


Description: AMISYN Polyclonal Antibody, Host: Rabbit, FITC Conjugated, Emmission: 494nm/518nm, Species: Human, Mouse, Rat, Isotype: IgG, Synonymns: Amisyn; HSPC156; STXB6_HUMAN; STXBP6, Application: IHC-P, IF(IHC-P), 100ul
Catalog Number: 10247-162
Supplier: Bioss


Description: STEAP3/TSAP6, Polyclonal antibody, Host: Rabbit, Species: Human, Mouse, Isotype: IGG Purity: Immunogen affinity purified, Synonyms: pHyde, six transmembrane prostate protein 3, Six-transmembrane epithelial antigen of prostate 3, Applications: WB, Size: 100ul
Catalog Number: 103285-774
Supplier: Novus Biologicals