186  results were found

SearchResultCount:"186"

Sort Results

List View Easy View (new)

Rate These Search Results

Catalog Number: (76790-504)
Supplier: AMBEED, INC
Description: Tetrapropylammonium hydroxide, Purity: 40% w/w in water, CAS Number: 4499-86-9, Appearance: Form: liquid, Storage: Sealed in dry, Room Temperature, Size: 25G


Catalog Number: (103006-264)
Supplier: Anaspec Inc
Description: Beta - Amyloid (3 - 40), Human, Purity: HPLC greater than or equal to 95%, Sequence (One-Letter Code): EFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV, Molecular Weight: 4143.7, Appearance: Lyophilized white powder, Storage: -20 degree C, Size: 0.1 mg


Catalog Number: (TS36632-5000)
Supplier: THERMO FISHER SCIENTIFIC CHEMICALS


Catalog Number: (TCB1071-500ML)
Supplier: TCI America
Description: 500ML MDL Number: 00008281, RTECS: BO8575000, Beilstein: 12(000)00,1020, SDBS: , Mol. Formula: C10H17NO, Mol. Wt.: 167.25, Reaxsys: 3917256, PubChem SID: 87564015, CAS: 100-85-6, 100-85-6, C10H17NO, 167.25

Catalog Number: (77602-478)
Supplier: AMBEED, INC

New Product


Catalog Number: (76307-986)
Supplier: VWR International

Environmentally Preferable


Catalog Number: (76307-990)
Supplier: VWR International

Environmentally Preferable


Catalog Number: (77661-482)
Supplier: VWR International

New Product


Catalog Number: (77661-484)
Supplier: VWR International

New Product


Catalog Number: (BDH7300-4)
Supplier: VWR International
Description: APHA 4500-C1 and ASTM 1253-91 for chlorine. Standardized at 25°C against chemicals whose certification is traceable to NIST.

Catalog Number: (MFLX32700-02)
Supplier: VWR International

CE Compliant


Catalog Number: (77675-194)
Supplier: SOLVENTUM PURIFICATION INC

New Product


Catalog Number: (76376-852)
Supplier: Sartorius
Description: Entris II* Essential Analytical balance, with Internal Calibration 220g, Readability/Scale Interval (d) 0.1mg, Anti-Theft Locking Device, LED screen with touch technology, Power Requirements: 100-240 V, Dimensions: 219 x 317 x 345 mm


Catalog Number: (76950-074)
Supplier: ANTIBODIES.COM LLC


Catalog Number: (94014-008)
Supplier: National Marker


Catalog Number: (76191-354)
Supplier: Brady Worldwide
Description: Printer i7100 300dpi Industrial Label, Direct Thermal/Thermal Transfer, Tape Width: 4.33 in, Color Printing Capability: Single Color, Voltage: 100 to 240 V, Display Type: Color Touch Screen, Barcode Capable, Minimum Label Length: 0.125 in


Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
In order to process your orders without delay, we request that you provide the required business documentation to purchase this product.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • State issued document with your organization's Federal Tax ID Number
  • State issued document with your organization's Resale Tax ID Number
  • City or County issued Business License
  • State Department of Health Services License
  • Any other ID issued by the State that includes the business name and address

* Please note if your account is within the State of California two of these pieces of identification will be required.
VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
161 - 176 of 186
no targeter for Bottom