460  results were found

SearchResultCount:"460"

Sort Results

List View Easy View (new)

Rate These Search Results

Catalog Number: (76171-138)
Supplier: Boster Biological Technology
Description: SMAD1/SMAD5 Picoband, Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Rat, Immunogen: A synthetic peptide corresponding to a sequence of human SMAD1/SMAD5 (KRLLGWKQGDEEEKWAEKAVDALVKKLKKKKGAMEELEK), Synonym: BSP-1, SMAD1, Application: WB, Size:100ug


Catalog Number: (76174-292)
Supplier: Boster Biological Technology
Description: AMPK Beta 1 Picoband*, Polyclonal Antibody, Host: Rabbit, Species: Human, Isotype: IgG, Immunogen: 32-68aa DRPKILMDSPEDADLFHSEEIKAPEKEEFLAWQHDLE, Synonyms: 5'-AMP-activated protein kinase subunit beta-1, Application: WB, Size: 100ug/vial


Catalog Number: (10207-092)
Supplier: Boster Biological Technology
Description: SHP2 Polyclonal Antibody, Host: Rabbit, Species: Human, Isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human SHP2(578-592aa EDSARVYENVGLMQQ), identical to the related rat and mouse sequences, Application: Western Blot, IHC-P


Catalog Number: (10209-900)
Supplier: Boster Biological Technology
Description: Sandwich PicoKine* elisa kit of Quantitative Detection for Human CD25/IL-2sR alpha Immunogen: please inquire Assay range: 78pg/ml-5000pg/ml Sensitivity: < 5 pg/ml, Sample Type: cell culture supernates, serum and plasma(heparin, EDTA), 96-well plate precoated


Catalog Number: (10206-154)
Supplier: Boster Biological Technology
Description: CDC6 antibody, Monoclonal, Host: Mouse IgG, Clone number: IMD-6, Synonyms: CDC18L/HsCdc18/p62(cdc6)/CELL DIVISION CYCLE 18, S. POMBE, HOMOLOG-LIKE/CDC6(cell division cycle 6, S. cerevisiae) homolog, Reactivity: Human, Immunogen: Recombinant human Cdc6. Application: WB


Catalog Number: (76172-440)
Supplier: Boster Biological Technology
Description: FGF23 PicoKine* ELISA Kit, Sensitivity: <10pg/ml, Sample type: cell culture supernates, cell lysates, serum and plasma (heparin, EDTA), Species: Mouse, Assay: 15.6pg/ml, Sandwich High Sensitivity ELISA kit for Quantitative Detection, Size: 96wells/kit


Catalog Number: (10209-002)
Supplier: Boster Biological Technology
Description: Sandwich Picokine* ELISA kit of quantitative detection for mouse MADCAM-1 Immunogen: NSO, Q22-T365 Assay range: 125pg/ml-8000pg/ml Sensitivity: < 10 pg/ml 96-well plate precoated Sample Type: cell culture supernates and serum.


Catalog Number: (76172-136)
Supplier: Boster Biological Technology
Description: Horse Equine TGF Alpha PicoKine* ELISA Kit, Sensitivity: <1pg/ml, Sample type: cell culture supernates, serum, plasma(heparin, EDTA) and horse equine milk, Species: Equine, Assay: 15.6pg/ml, Sandwich High Sensitivity, Size: 96wells/kit


Catalog Number: (76466-824)
Supplier: Boster Biological Technology
Description: FLRT2 ELISA Kit, Sample Volume: 100ul per well, Reactivity: Mouse, Sensitivity: <10pg/ml, Assay Range: 31.2-2000pg/ml, Immunogen: StandardExpression system: NSO, sequence: C36-T660 Alternative Names: Flrt2, Fibronectin Leucine Rich Transmembrane Protein 2, Size: 96wells/kit, with removable strips.


Catalog Number: (76173-536)
Supplier: Boster Biological Technology
Description: PSCA Picoband* Polyclonal Antibody, Host: Rabbit, Species reactivity: Human, Mouse, Rat, Immunogen: E.coli-derived human PSCA recombinant protein (L21-S95), Synonyms: Prostate stem cell antigen; PSCA, Application: Western blot, size: 100ug/vial


Catalog Number: (10206-356)
Supplier: Boster Biological Technology
Description: Oncostatin M antibody, Polyclonal, Host: Rabbit IgG, Reactivity: Human, Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human Oncostatin M(181-198aa ASDAFQRKLEGCRFLHGY). Application: IHC-P, WB


Catalog Number: (76173-966)
Supplier: Boster Biological Technology
Description: EDNRB/Endothelin B Receptor Picoband*, Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Rat, Isotype: IgG, Immunogen: 406-439aa QSFEEKQSLEEKQSCLKFKANDHGYDNFRSSNKY, Synonyms: Endothelin B receptor, Size: 100ug/vial


Catalog Number: (76465-690)
Supplier: Boster Biological Technology
Description: Forkhead box protein I1 FOXI1 Polyclonal Antibody, Host: Rabbit, Reactivity: Human, Rat, Isotype: IgG, Immunogen: E.coli-derived human FOXI1 recombinant protein (Position: M1-V378), Alternative Names: FOXI1, FKHL10HFH3, forkhead box I1, forkhead box protein I1, forkhead-like 10, Size: 100ug/vial


Catalog Number: (76173-836)
Supplier: Boster Biological Technology
Description: BAK Picoband*, Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Rat, Isotype: IgG, Immunogen: E.coli-derived human BAK recombinant protein, Synonyms: Bcl2-L-7, BAK1, BAK, BCL2L7, CDN1, Application: WB, IHC-P, IHC-F, ICC, Size: 100ug/vial


Catalog Number: (76171-498)
Supplier: Boster Biological Technology
Description: Semaphorin 3A Picoband, Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Rat, Immunogen: E. Coli-derived human Semaphorin 3A recombinant protein, Synonym: Semaphorin-3A, Semaphorin III, Sema III, SEMA3A, SEMAD, Application: ELISA, WB, Size:100ug


Catalog Number: (76170-854)
Supplier: Boster Biological Technology
Description: Leptin Picoband, Polyclonal Antibody, Host: Rabbit, Species Reactivity: Rat, Immunogen: E. Coli-derived rat Leptin recombinant protein (Position: V22-C167), Synonym: Leptin, Obesity factor, Lep, Ob, Application: ELISA, WB, Size:100ug


Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
In order to process your orders without delay, we request that you provide the required business documentation to purchase this product.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • State issued document with your organization's Federal Tax ID Number
  • State issued document with your organization's Resale Tax ID Number
  • City or County issued Business License
  • State Department of Health Services License
  • Any other ID issued by the State that includes the business name and address

* Please note if your account is within the State of California two of these pieces of identification will be required.
VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
no targeter for Bottom