Print…

You Searched For: 3,4-Diaminoanisole


613,157  results were found

Refine Results Sort by

Sort Results

List View Easy View (new)
SearchResultCount:"613157"

Rate These Search Results

Image Unavailable-103015-268

ROR1 Protein, Fc Tag 1mg

Description: ROR1 Protein, Fc Tag, Host: HEK293, Species Reactivity: Human, Purity: >95% by SDS-PAGE, Molecular Characterization: fused with Fc fragment of human IgG1 at the C-terminus, calculated MW of 68.6 kDa, Endotoxin: < 1.0 EU/ ug, Synonym: ROR1, NTRKR1, Storage: 4deg C, Size: 1mg
Catalog Number: 103015-268
Supplier: ACROBIOSYSTEMS
Image Unavailable-103012-736

Human Dkk-1 Protein 1mg

Description: Human Dkk-1 Protein, Host: HEK293 cells, Species Reactivity: Human, purity: >95% SDS-PAGE, Molecular Characterization: fused with GST tag at the C-terminus, MW of 25.8 kDa, Endotoxin: Less than 1.0 EU per ug of the Human Dkk-1, Synonym: DKK1,SK, size: 1mg
Catalog Number: 103012-736
Supplier: ACROBIOSYSTEMS
Image Unavailable-103014-690

Human IL-2 R alpha/CD25 Protein Fc Tag

Description: IL-2 R alpha / CD25 Protein, Fc Tag, Host: HEK293 Cells, Species Reactivity: Human, purity: >95%, Molecular Characterization: human IgG1 Fc tag at the C-terminus, MW of 48.4 Kda, Synonym: IL2RA, CD25, p55,IL2-RA, IL-2-RA, Storage: 4 deg C, Size: 1MG
Catalog Number: 103014-690
Supplier: ACROBIOSYSTEMS
Image Unavailable-103014-692

Human IL-2 R alpha/CD25 Protein Fc Tag

Description: IL-2 R alpha / CD25 Protein, Fc Tag, Host: HEK293 Cells, Species Reactivity: Human, purity: >95%, Molecular Characterization: human IgG1 Fc tag at the C-terminus, MW of 48.4 Kda, Synonym: IL2RA, CD25, p55,IL2-RA, IL-2-RA, Storage: 4 deg C, Size: 100UG
Catalog Number: 103014-692
Supplier: ACROBIOSYSTEMS
Image Unavailable-103015-270

ROR1 Protein, Fc Tag 200ug

Description: ROR1 Protein, Fc Tag, Host: HEK293, Species Reactivity: Human, Purity: >95% by SDS-PAGE, Molecular Characterization: fused with Fc fragment of human IgG1 at C-terminus, calculated MW of 68.6 kDa, Endotoxin: < 1.0 EU/ ug, Synonym: ROR1, NTRKR1, Storage: 4deg C, Size: 200ug
Catalog Number: 103015-270
Supplier: ACROBIOSYSTEMS
Image Unavailable-103815-214

ErbB3/Her3 Protein, Species Reactivity: Human ErbB3, Host: HEK293, Purity: >95%, Molecular Weight: 72.4Kda, Molecular Characterization: protein carries a polyhistidine tag at the C-terminus, Conjugate: Biotin, Synonym: ERBB3, HER3, Storage: lyophilized state at -20 deg C or lower, Size: 25ug

Description: ErbB3/Her3 Protein, Species Reactivity: Human ErbB3, Host: HEK293, Purity: >95%, Molecular Weight: 72.4Kda, Molecular Characterization: protein carries a polyhistidine tag at the C-terminus, Conjugate: Biotin, Synonym: ERBB3, HER3, Storage: lyophilized state at -20 deg C or lower, Size: 25ug
Catalog Number: 103815-214
Supplier: ACROBIOSYSTEMS
Image Unavailable-103815-212

ErbB3/Her3 Protein, Species Reactivity: Human, Host: HEK293 cells, Purity: >95%, Molecular Weight: 72.4Kda, Molecular Characterization: protein carries a polyhistidine tag at the C-terminus, Conjugate: Biotin, Synonym: ERBB3, HER3, Storage: lyophilized state at -20 deg C or lower, Size: 200ug

Description: ErbB3/Her3 Protein, Species Reactivity: Human, Host: HEK293 cells, Purity: >95%, Molecular Weight: 72.4Kda, Molecular Characterization: protein carries a polyhistidine tag at the C-terminus, Conjugate: Biotin, Synonym: ERBB3, HER3, Storage: lyophilized state at -20 deg C or lower, Size: 200ug
Catalog Number: 103815-212
Supplier: ACROBIOSYSTEMS
Image Unavailable-103008-016

[Lys(Me1)4]-Histone H3 (1-10) H3K4(Me1) 1 mg

Description: [Lys(Me1)4]-Histone H3 (1-10), H3K4(Me1), Sequence: ART-K(Me1)-QTARKS, Purity: By HPLC greater than or equal to 95%, peptide is Histone H3 amino acid residues 1 to 10 mono-methylated at Lys-4, Molecular Weight: 1160.3, Storage: -20 deg C, Size: 1 mg
Catalog Number: 103008-016
Supplier: Anaspec Inc
Image Unavailable-103003-158

Adrenomedullin (1-50) rat 0.5 mg

Description: Adrenomedullin (1-50), rat, Purity: HPLC >/- 95%, Molecular Weight: 5729.5, Sequence: YRQSMNQGSRSTGCRFGTCTMQKLAHQIYQFTDKDKDGMAPRNKISPQGY-NH2, Rat adrenomedullin, rADM, (1-50) and its C-terminal rADM (11-50) induce a dose-dependent, Storage: -20 deg C, Size: 0.5 mg
Catalog Number: 103003-158
Supplier: Anaspec Inc
Image Unavailable-103008-180

Histone H3 (21-44) 1mg

Description: Histone H3 (21-44), Purity: Greater than or equal to 95% (HPLC), Molecular weight: 2505.9, Sequence: ATKAARKSAPATGGVKKPHRYRPG, derived from Histone H3 21-44 amino acids, used as a substrate for protein arginine methyltransferases, Storage: -20 degree C, Size: 1mg
Catalog Number: 103008-180
Supplier: Anaspec Inc
Image Unavailable-103006-974

IRS1-derived peptide 1 mg

Description: IRS1-derived peptide fragment (979-989) of the insulin receptor substrate-1 containing the sequence motif YMXM, Purity: HPLC greater than or equal to 95%, Sequence (One-Letter Code): KKSRGDYMTMQIG-NH2, Molecular Weight: 1513.8, Storage: -20 degree C, Size: 1 mg
Catalog Number: 103006-974
Supplier: Anaspec Inc
Image Unavailable-103013-240

Recombinant [A/Guinea fowl/Hong Kong/WF10/99 (H9N2)] (HA1)

Description: Recombinant [A/Guinea fowl/Hong Kong/WF10/99 (H9N2)] Hemagglutinin 1(HA1), Host: HEK293 Cells, Species: Influenza, Purity: >95% SDS-PAGE, Molecular Characterization: Fused with a polyhistidine tag at C-terminus, Synonym: HA1, Size: 1mg
Catalog Number: 103013-240
Supplier: ACROBIOSYSTEMS
Product Image-470175-930

LAMBDA DNA/HIND III DIG-FREEZE UPON RCPT

Catalog Number: 470175-930
Supplier: VWR
Image Unavailable-103013-214

Recombinant HIV-1 [HIV-1/Clade C (16055)] GP120 100ug

Description: Recombinant [HIV-1/Clade C (16055)] GP120, Host: HEK293 Cells, Species reactivity: HIV, Purity: >95%SDS-PAGE, Molecular Characterization: Fused with a polyhistidine tag at the C-terminus, MW 54 kDa, Synonym: GP120, GP120-16055, Size: 100ug
Catalog Number: 103013-214
Supplier: ACROBIOSYSTEMS
Image Unavailable-103013-212

Recombinant HIV-1 [HIV-1/Clade C (16055)] GP120 1mg

Description: Recombinant [HIV-1/Clade C (16055)] GP120, Host: HEK293 Cells, Species reactivity: HIV, Purity: >95%SDS-PAGE, Molecular Characterization: Fused with a polyhistidine tag at the C-terminus, MW of 54 kDa, Synonym: GP120, GP120-16055, Size: 1mg
Catalog Number: 103013-212
Supplier: ACROBIOSYSTEMS
Image Unavailable-103014-208

Cynomolgus CD3 epsilon Protein His Tag & Fc Tag

Description: CD3 epsilon Protein, His Tag & Fc Tag, Host: HEK293 cells, Species Reactivity: Cynomolgus, Purity: >95% (SDS-PAGE), Molecular Characterization: Fc Chimera fused with polyhistidine tag at C-terminus, MW 38.3KDa, Synonyms: FLJ18683, Size: 100ug
Catalog Number: 103014-208
Supplier: ACROBIOSYSTEMS
1 - 16 of 613,157