You Searched For: BOSTER BIOLOGICAL TECHNOLOGY CO LTD


5,847  results were found

Sort Results

List View Easy View (new)
SearchResultCount:"5847"
Description: VWF/Von Willebrand Factor Picoband* Polyclonal Antibody, Host: Rabbit, Species reactivity: Mouse, Rat, Immunogen: E.coli-derived mouse VWF recombinant protein (M1304-E1452), Synonyms: von Willebrand factor; vWF, Application: WB, size: 100ug/vial
Catalog Number: 76173-380
Supplier: Boster Biological Technology


Description: Non-muscle Myosin IIB Polyclonal Antibody, Host: Rabbit, Reactivity: Human, Mouse, Rat, Immunogen: A synthetic peptide corresponding to a sequence of non-muscle Myosin IIB/MYH10 Alternative Names: non-muscle heavy chain 10 Myosin, cellular myosin heavy chain, Size: 100ug/vial
Catalog Number: 76464-968
Supplier: Boster Biological Technology


Description: DKK-1 PicoKine* ELISA Kit, Sensitivity: <15pg/ml, Sample type: cell culture supernates, cell lysates, serum and plasma (heparin, EDTA), Species reactivity: Rat, Assay: 46.9pg/ml, Sandwich High Sensitivity ELISA kit for Quantitative Detection, Size: 96wells/kit
Catalog Number: 76172-334
Supplier: Boster Biological Technology


Description: Heparanase 1 Picoband, Polyclonal Antibody, Host: Rabbit, Species Reactivity: Mouse, Immunogen: E.coli-derived mouse Heparanase 1 recombinant protein (Position: K206-K457, Synonym: Heparanase, 3.2.1.166, Application: WB, Size:100ug
Catalog Number: 76171-408
Supplier: Boster Biological Technology


Description: Apolipoprotein D antibody, polyclonal, Host: Rabbit, Isotype: IgG, Species reactivity: Human, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Apolipoprotein D(172-189aa IDVKKMTVTDQVNCPKLS).Application: WB
Catalog Number: 10207-952
Supplier: Boster Biological Technology


Description: SHP2 Picoband*, Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Rat, Isotype: IgG, Immunogen: 69-99aa EKFATLAELVQYYMEHHGQLKEKNGDVIELK, Synonyms: Tyrosine-protein phosphatase non-receptor type 11, Application: WB, IHC-P, Size: 100ug/vial
Catalog Number: 76174-166
Supplier: Boster Biological Technology


Description: HSD17B6 antibody, Polyclonal, Host: Rabbit IgG, Reactivity: Human, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human HSD17B6(300-317aa SLADYILTRSWPKPAQAV). Application: IHC-P, WB
Catalog Number: 10206-602
Supplier: Boster Biological Technology


Description: MTCO1 polyclonal antibody, Host: Rabbit, Species reactivity: Human, isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human MTCO1(501-514aa PYHTFEEPVYMKS).
Catalog Number: 10209-546
Supplier: Boster Biological Technology


Description: RANK/Tnfrsf11a Polyclonal Antibody, Host: Rabbit, Reactivity: Mouse, Rat, Isotype: IgG, Immunogen: E.coli-derived mouse RANK/Tnfrsf11a recombinant protein (Position: Q30-R203), Alternative Names: RANK/TNFRSF11A, CD265 antigen, CD265, FEO, Applications: ELISA, Flow Cytometry, WB, Size: 100ug/vial
Catalog Number: 76464-120
Supplier: Boster Biological Technology


Description: IL-5 ELISA Kit EZ-Set* (DIY Antibody Pairs), Sample Volume: 100ul per well, Reactivity: Human, Sensitivity: <2pg/ml, Assay Range: 7.8pg/ml-500pg/ml Alternative Name: IL-5, BCDF mu Alternative Name: IL-5, BCDF mu, Size: For 5 plates, 96 wells each, reagents only, plates are not included
Catalog Number: 76467-144
Supplier: Boster Biological Technology


Description: PGK1 Picoband*, Polyclonal Antibody, Host: Rabbit, Species: Human, Rat, Isotype: IgG, Immunogen: 312-337aa MGLDCGPESSKKYAEAVTRAKQIVWN, Synonyms: Primer recognition protein 2, PRP 2, PGK1, Application: Western Blot, storage: -20 deg C, size: 100ug/vial
Catalog Number: 76174-364
Supplier: Boster Biological Technology


Description: CD1c/Bdca 1 Picoband, Polyclonal Antibody, Host: Rabbit, Species Reactivity: Human, Immunogen: E. Coli-derived human CD1c recombinant protein (Position: K73-L287), Synonym: T-cell surface glycoprotein CD1c, CD1c, CD1C, Application: WB, Size:100ug
Catalog Number: 76171-356
Supplier: Boster Biological Technology


Description: Contactin-4 ELISA Kit, Sample Volume: 100ul per well, Reactivity: Human, Sensitivity: <50pg/ml, Assay Range: 312pg/ml-20000pg/ml, Immunogen: StandardExpression system for standard: NSO, sequence: D19-S1000 Alternative Names: Contactin-4, AXCAM, Size: 96wells/kit, with removable strips.
Catalog Number: 76466-602
Supplier: Boster Biological Technology


Description: SLC1A4 antibody, Polyclonal, Host: Rabbit IgG, Reactivity: Human, Mouse, Rat, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human SLC1A4(495-512aa EAIPNCKSEEETSPLVTH).
Catalog Number: 10206-756
Supplier: Boster Biological Technology


Description: Serpin D1 ELISA Kit, Sample Volume: 100ul per well, Reactivity: Human, Sensitivity: <0.1ng/ml, Assay Range: 0.78ng/ml-50ng/ml, Immunogen: StandardExpression system: NSO, sequence: G20-S499, Alternative Name: Serpin D1/Heparin Cofactor II, HC2, HC2LS2, HCF2, Size: 96wells/kit, with removable strips.
Catalog Number: 76466-816
Supplier: Boster Biological Technology


Description: Sandwich Picokine* ELISA kit of quantitative detection for human IL1R2 Immunogen: sf21, F14-E343 Assay range: 31.2pg/ml-2000pg/ml Sensitivity: < 10 pg/ml 96-well plate precoated Sample Type: cell culture supernates and serum.
Catalog Number: 10207-754
Supplier: Boster Biological Technology


1,489 - 1,504 of 5,847