You Searched For: Alpha Protech


5,847  results were found

SearchResultCount:"5847"

Sort Results

List View Easy View (new)

Rate These Search Results

Catalog Number: (10207-114)
Supplier: Boster Biological Technology
Description: SSX2 Polyclonal Antibody, Host: Rabbit, Species: Human Mouse Rat, Isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Protein SSX2(157-184aa NREAQEKEERRGTAHRWSSQNTHNIGRF), Application: Western Blot


Catalog Number: (76172-428)
Supplier: Boster Biological Technology
Description: Neuropilin-1 PicoKine* ELISA Kit, Sensitivity: <10pg/ml, Sample type: cell culture supernates, cell lysates, serum and plasma (heparin, EDTA), Species: Human, Assay: 0.78ng/ml, Sandwich High Sensitivity for Quantitative Detection, Size: 96wells/kit


Catalog Number: (76463-548)
Supplier: Boster Biological Technology
Description: Bcl-XL BCL2L1 Polyclonal Antibody, Host: Rabbit, Reactivity: Human, Isotype: IgG, Conjugate: DyLight* 488, Immunogen: E.coli-derived Bcl-XL recombinant protein (Position: M1-T219). Bcl-XL shares 97.9% amino acid (aa) sequence Alternative Names: BCL2L1, Apoptosis regulator Bcl-X, Size: 50ug/vial


Catalog Number: (76467-006)
Supplier: Boster Biological Technology
Description: GFRA1 ELISA Kit, Sample Volume: 100ul per well, Reactivity: Mouse, Sensitivity: <10pg/ml, Assay Range: 15.6pg/ml-1000pg/ml, Alternative Names: GFR alpha-1/GDNF R alpha-1, DKFZp313E1012, DKFZp686J0156, GDNF family receptor alpha 1, Size: 96wells/kit, with removable strips.


Catalog Number: (10209-000)
Supplier: Boster Biological Technology
Description: Sandwich Picokine* ELISA kit of quantitative detection for human CD21/CR2 Immunogen: CHO, Ile21-71 Assay range: 0.78ng/ml-50ng/ml Sensitivity: < 20 pg/ml 96-well plate precoated Sample Type: cell culture supernates, serum and plasma(heparin, EDTA).


Catalog Number: (76171-096)
Supplier: Boster Biological Technology
Description: GAS 6 Picoband, Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Rat, Immunogen: E.coli-derived human GAS 6 recombinant protein (Position: M488-S660, Synonym: AXL receptor tyrosine kinase ligand, GAS6, AXLLG, Application: IHC-P, WB, Size:100ug


Catalog Number: (76171-830)
Supplier: Boster Biological Technology
Description: Picoband*VEGFB Polyclonal antibody, Host: Rabbit, Species: Human, Mouse, Rat, Immunogen: E. Coli-derived human VEGFB recombinant protein (Position: Q25-A138), Synonyms: Vascular endothelial growth factor B, Application: ELISA, WB, Size: 100ug/vial


Catalog Number: (76174-990)
Supplier: Boster Biological Technology
Description: SR1 Polyclonal Antibody, Host: Rabbit, Species Reactivity: Human, Rat, Isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human SR1 (89-116aa), Synonym: Sorcin, Application: Western blot (WB), Size: 100 ug/vial


Catalog Number: (76174-672)
Supplier: Boster Biological Technology
Description: Bcl-X Picoband*, Polyclonal Antibody, Host: Rabbit, Species: Human, Isotype: IgG, Immunogen: 75-105aa LDAREVIPMAAVKQALREAGDEFELRYRRAF, Synonyms: Bcl-2-like protein 1, Bcl2-L-1, Apoptosis regulator Bcl-X, BCL2L1, BCL2L, BCLX, Size: 100ug/vial


Catalog Number: (76173-136)
Supplier: Boster Biological Technology
Description: IL-18 Polyclonal Antibody, Host: Rabbit, Species reactivity: Human, Immunogen: E.coli-derived human IL-18 recombinant protein (Y37-D193), Synonyms: Interleukin-18; IL-18, IL-1 gamma;IL18;IGIF, IL1F4, Application: IHC-P, ICC, Western Blot, size: 100ug/vial


Catalog Number: (10206-808)
Supplier: Boster Biological Technology
Description: TFPI2 Polyclonal Antibody, Host: Rabbit, Species: Human, Isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human TFPI2(170-186aa NVTRYYFNPRYRTCDAF), Application: IHC-P, Western Blot


Catalog Number: (76467-358)
Supplier: Boster Biological Technology
Description: P-Selectin / CD62P Quick ELISA Kit, Reactivity: Mouse, Sample Type: cell culture supernatants, serum and plasma (citrate), Sample Volume: 100ul per well, Sensitivity: <5pg/ml, Assay Range: 312-20000pg/ml, Alternative Names: P-Selectin/CD62P, CD62P antigen, Size: 96wells/kit, with removable strips.


Catalog Number: (76170-816)
Supplier: Boster Biological Technology
Description: CD11b Picoband, Polyclonal Antibody, Host: Rabbit, Species Reactivity: Mouse, Immunogen: E. Coli-derived mouse CD11b recombinant protein (Position: E260-T360), Synonym: Integrin alpha-M, CD11 antigen-like family member B, Application: WB, Size:100ug


Catalog Number: (10206-652)
Supplier: Boster Biological Technology
Description: ADAMTS1 antibody, Polyclonal, Host: Rabbit IgG, Reactivity: Mouse, Rat, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of mouse ADAMTS1(956-968aa KHYIDFCTLTQCS).


Catalog Number: (76171-252)
Supplier: Boster Biological Technology
Description: HDAC4/Histone Deacetylase 4 Picoband, Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Rat, Immunogen: E.coli-derived human HDAC4 recombinant protein (Position: Q4-Q213, Synonym: HD4, 3.5.1.98, Application: WB, Size:100ug


Catalog Number: (76174-186)
Supplier: Boster Biological Technology
Description: ARID1A Picoband*, Polyclonal Antibody, Host: Rabbit, Species: Human, Isotype: IgG, Immunogen: 1021-1053aa KMWVDRYLAFTEEKAMGMTNLPAVGRKPLDLYR, Synonyms: AT-rich interactive domain-containing protein 1A, Application: WB, Size: 100ug/vial


Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
In order to process your orders without delay, we request that you provide the required business documentation to purchase this product.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • State issued document with your organization's Federal Tax ID Number
  • State issued document with your organization's Resale Tax ID Number
  • City or County issued Business License
  • State Department of Health Services License
  • Any other ID issued by the State that includes the business name and address

* Please note if your account is within the State of California two of these pieces of identification will be required.
VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
113 - 128 of 5,847
no targeter for Bottom