You Searched For: BOSTER BIOLOGICAL TECHNOLOGY CO LTD


5,847  results were found

Sort Results

List View Easy View (new)
SearchResultCount:"5847"
Description: Sandwich Picokine* ELISA kit of quantitative detection for human IL-33 Immunogen: E.coli, S112-T270 Assay range: 15.6pg/ml-1000pg/ml Sensitivity: < 10 pg/ml 96-well plate precoated Sample Type: cell culture supernates, serum, plasma(heparin, EDTA) and cell lysates.
Catalog Number: 10207-848
Supplier: Boster Biological Technology


Description: Soluble CD6 Quick ELISA Kit, Reactivity: Human, Sample Type: cell culture supernatants, cell lysates, serum and plasma, Sample Volume: 100ul per well, Sensitivity: <10pg/ml, Assay Range: 156-10,000pg/ml, Alternative Names: CD6, CD6 antigenFLJ44171, Size: 96wells/kit, with removable strips.
Catalog Number: 76467-424
Supplier: Boster Biological Technology


Description: TRIF Polyclonal Antibody, Host: Rabbit, Species: Human, Isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of mouse TRIF(693-708aa NNHMWGHTGAQSSDDK), Application: Western Blot
Catalog Number: 10207-338
Supplier: Boster Biological Technology


Description: TFRC/Transferrin Receptor Picoband* Polyclonal Antibody, Host: Rabbit, Species reactivity: Human, Immunogen: E.coli-derived human TFRC recombinant protein (M1-N198), Synonyms: Transferrin receptor protein 1; TR, Application: WB, size: 100ug/vial
Catalog Number: 76173-332
Supplier: Boster Biological Technology


Description: Bid antibody, polyclonal, Host: Rabbit, Isotype: IgG, Species reactivity: Mouse, Rat, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of mouse Bid(179-195aa NQNLFSYVRNLVRNEMD), different from the related rat sequence by one amino acid.
Catalog Number: 10208-848
Supplier: Boster Biological Technology


Description: Cystathionase Picoband*, Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Rat, Isotype: IgG, Immunogen: E.coli-derived human Cystathionase recombinant protein, Synonyms: Cystathionine gamma-lyase, 4.4.1.1, Application: WB, Size: 100ug/vial
Catalog Number: 76173-856
Supplier: Boster Biological Technology


Description: Sandwich Picokine* ELISA kit of quantitative detection for human Flt-3ligand Immunogen: sf21, T27-P185 Assay range: 15.6pg/ml-1000pg/ml Sensitivity: < 10 pg/ml 96-well plate precoated Sample Type: cell culture supernates, serum and plasma(heparin, EDTA, citrate).
Catalog Number: 10207-632
Supplier: Boster Biological Technology


Description: Beclin 1 antibody, Polyclonal, Host: Rabbit IgG, Reactivity: Human, Mouse, Rat, Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human Beclin 1(222-237aa LDQEEAQYQREYSEFK), identical to the related rat and mouse sequences.
Catalog Number: 10206-580
Supplier: Boster Biological Technology


Description: LASP1 antibody, Polyclonal, Host: Rabbit, Reactivity: Human, Mouse, RatRabbit IgG, Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human LASP1, Application: IHC-P, ICC, WB.
Catalog Number: 10209-966
Supplier: Boster Biological Technology


Description: IL17RA/Il 17R, Polyclonal Antibody, Host: Rabbit, Species: Human, Immunogen: E. Coli-derived human IL17RA recombinant protein Position: K53-Q284, Synonym: Interleukin-17 receptor A, IL-17 receptor A, IL-17RA, CDw217, CD217, IL17RA, Application: ELISA, WB, Size:100ug
Catalog Number: 76171-404
Supplier: Boster Biological Technology


Description: Sandwich PicoKine* ELISA kit of Quantitative Detection for Rat BTC, Immunogen: E.coli, D32-Y111, Assay range: 7.8pg/ml-500pg/ml, Sensitivity: < 10 pg/ml, Sample type: cell culture supernates, serum and plasma(heparin, EDTA), 96-well plate precoated
Catalog Number: 10205-880
Supplier: Boster Biological Technology


Description: Follistatin Picoband, Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Rat, Immunogen: E. Coli-derived human Follistatin recombinant protein (Position: N31-K261), Synonym: Follistatin, FS, Activin-binding protein, FST, Application: ELISA, WB, Size:100ug
Catalog Number: 76171-254
Supplier: Boster Biological Technology


Description: KIAA0652 Picoband*, Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Isotype: IgG, Immunogen: 488-517aa MAEDLDSLPEKLAVHEKNVREFDAFVETLQ, Synonyms: Autophagy-related protein 13, ATG13, KIAA0652, Application: WB, Size: 100ug/vial
Catalog Number: 76173-828
Supplier: Boster Biological Technology


Description: CEA Quick ELISA Kit, Reactivity: Human, Sample Type: cell culture supernatants, cell lysates, serum and plasma, Sample Volume: 100ul per well, Sensitivity: <10pg/ml, Assay Range: 312-20,000pg/ml, Alternative Names: Carcinoembryonic antigen, Size: 96wells/kit, with removable strips.
Catalog Number: 76467-402
Supplier: Boster Biological Technology


Description: Unconjugated Goat Anti-mouse IgG secondary antibody This antibody is specific for mouse IgG and shows no cross-reactivity with human/bovine/rabbit IgG, Application: ELISA, IF, IHC-P, IHC-F, ICC, WesternBlot, Pack size: 1mg
Catalog Number: 10207-542
Supplier: Boster Biological Technology


Description: AGTR1 Picoband*, Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Isotype: IgG, Immunogen: 1-28aa MILNSSTEDGIKRIQDDCPKAGRHNYIF), Synonyms: Type-1 angiotensin II receptor, AT1AR, AT1BR, Application: WB, IHC-P, Size: 100ug/vial
Catalog Number: 76173-762
Supplier: Boster Biological Technology


1,409 - 1,424 of 5,847