You Searched For: BOSTER BIOLOGICAL TECHNOLOGY CO LTD


5,847  results were found

Sort Results

List View Easy View (new)
SearchResultCount:"5847"
Description: Desmin Picoband* Polyclonal antibody, Host: Rabbit, Species Reactivity: Human, Mouse, Rat, isotype: IgG, E.coli-derived human Desmin recombinant protein (Position: M1-T304). Human Desmin shares 97% amino acid (aa) sequence identity with both mouse and rat Desmin
Catalog Number: 10209-514
Supplier: Boster Biological Technology


Description: Sandwich Picokine* ELISA kit of quantitative detection for mouse Neuropilin-2 Immunogen: NSO, Q23-D863 Assay range: 156pg/ml-10, 000pg/ml Sensitivity: < 10 pg/ml 96-well plate precoated Sample Type: cell culture supernates, cell lysates and tissue homogenates.
Catalog Number: 10207-620
Supplier: Boster Biological Technology


Description: E2F4 Picoband* Polyclonal Antibody, Host: Rabbit, Species reactivity: Human, Mouse, Rat, Immunogen: synthetic peptide corresponding to a sequence at the N-terminus (106-144aa), Synonyms: Transcription factor E2F4; E2F-4; E2F4, Application: WB, size: 100ug/vial
Catalog Number: 76173-028
Supplier: Boster Biological Technology


Description: Sandwich PicoKine* ELISA kit of Quantitative Detection for Human IL-17E/IL-25, Immunogen: E.coli, Y33-G177, Assay range: 62.5pg/ml-4000pg/ml, Sensitivity: < 10 pg/ml, Sample type: cell culture supernates, serum, and plasma(heparin, EDTA), 96-well plate precoated
Catalog Number: 10205-264
Supplier: Boster Biological Technology


Description: CD300F ELISA Kit, Sample Volume: 100ul per well, Reactivity: Human, Sensitivity: <10pg/ml, Assay Range: 31.2pg/ml-2000pg/ml, Alternative Names: CD300f/LMIR3/CD300LF, CMRF35-like molecule 1, CD300 molecule-like family member f, CD300f, Size: 96wells/kit, with removable strips.
Catalog Number: 76466-838
Supplier: Boster Biological Technology


Description: TREML1/Tlt 1 PicoKine* ELISA Kit, Sensitivity: <10pg/ml, Sample type: cell culture supernates, cell lysates, serum and plasma (heparin, EDTA), Species: Human, Assay: 15.6pg/ml, Sandwich High Sensitivity for Quantitative Detection, Size: 96wells/kit
Catalog Number: 76172-650
Supplier: Boster Biological Technology


Description: PROM1/Cd133 Picoband* Polyclonal Antibody, Host: Rabbit, Species reactivity: Human, Immunogen: E.coli-derived human PROM1 recombinant protein (P531-H865), Synonyms: Prominin-1; Antigen AC133;, Application: IHC-P, WB, size: 100ug/vial
Catalog Number: 76173-190
Supplier: Boster Biological Technology


Description: IL-4 ELISA Kit EZ-Set* (DIY Antibody Pairs), Sample Volume: 100ul per well, Reactivity: Human, Sensitivity: <1.5pg/ml, Assay Range: 15.6pg/ml-1000pg/ml, Immunogen: StandardExpression system : E.coli, sequence: H25-S1530, Size: For 5 plates, 96 wells each, reagents only, plates are not included
Catalog Number: 76467-140
Supplier: Boster Biological Technology


Description: Sandwich PicoKine* ELISA kit of Quantitative Detection for Human CXCL16, Immunogen: E.coli, N49-P137, Assay range: 93.7pg/ml-6000pg/ml, Sensitivity: < 10 pg/ml, Sample type: cell culture supernates, serum and plasma(heparin, EDTA), 96-well plate precoated
Catalog Number: 10205-634
Supplier: Boster Biological Technology


Description: TNFRSF18/Gitr Picoband, Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Rat, Immunogen: E. Coli-derived human TNFRSF18 recombinant protein (Position: L178-V241), Synonym: TNFRSF18, AITR, GITR, UNQ319/PRO364, Application: WB, Size:100ug
Catalog Number: 76171-712
Supplier: Boster Biological Technology


Description: APOE/Apolipoprotein E PicoKine* ELISA Kit, Sensitivity: <50pg/ml, Sample type: cell culture supernates, serum, plasma(heparin, EDTA), saliva, milk and urine, Species: Human, Assay: 3.12ng/ml, For Quantitative Detection, Size: 96wells/kit
Catalog Number: 76172-554
Supplier: Boster Biological Technology


Description: Sandwich Picokine* ELISA kit of quantitative detection for human RBP4 Immunogen: NSO, E19-L201 Assay range: 312pg/ml-20, 000pg/ml Sensitivity: < 10 pg/ml 96-well plate precoated Sample Type: Cell culture supernates, serum, plasma(heparin, EDTA) and urine.
Catalog Number: 10207-880
Supplier: Boster Biological Technology


Description: RbAp48 Picoband*, Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Rat, Isotype: IgG, Immunogen: 395-425aa EDNIMQVWQMAENIYNDEDPEGSVDPEGQGS, Synonyms: RBBP-4, Retinoblastoma-binding protein p48, RBBP4, RBAP48, Size: 100ug/vial
Catalog Number: 76174-450
Supplier: Boster Biological Technology


Description: Band 3 Picoband* Polyclonal Antibody, Host: Rabbit, Species reactivity: Human, Mouse, Rat, Immunogen: E. Coli-derived human Band 3 (E28-N365), Synonyms: Band 3 anion transport protein, Application: IHC-P, IHC-F, Western blot, size: 100ug/vial
Catalog Number: 76173-706
Supplier: Boster Biological Technology


Description: CXADR ELISA Kit, Sample Volume: 100ul per well, Reactivity: Rat, Sensitivity: <10pg/ml, Assay Range: 31.2pg/ml-2000pg/ml, Alternative Names: Cxadr, CAR10Coxsackievirus B-adenovirus receptor, CAR4/6, coxsackie virus and adenovirus receptor, Size: 96wells/kit, with removable strips.
Catalog Number: 76466-552
Supplier: Boster Biological Technology


Description: Glycine decarboxylase Polyclonal Antibody, Host: Rabbit, Reactivity: Human, Mouse, Rat, Immunogen: E.coli-derived Glycine decarboxylase/GLDC recombinant protein (Position: K574-S1020), Alternative Names: GLDC, EC 1.4.4.2, GCE, GCSPMGC138198, Glycine cleavage system P protein, Size: 100ug/vial
Catalog Number: 76465-394
Supplier: Boster Biological Technology


1,377 - 1,392 of 5,847