You Searched For: BOSTER BIOLOGICAL TECHNOLOGY CO LTD


5,847  results were found

Sort Results

List View Easy View (new)
SearchResultCount:"5847"
Description: Peroxiredoxin 3 antibody, Polyclonal, Host: Rabbit IgG, Reactivity: Human, Mouse, Rat, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of mouse Peroxiredoxin 3(240-257aa TIKPSPTASKEYFEKVHQ).
Catalog Number: 10206-280
Supplier: Boster Biological Technology


Description: Picoband*RECK Polyclonal antibody, Host: Rabbit, Species: Human, Mouse, Immunogen: A synthetic peptide corresponding to a sequence of human RECK, Synonyms: hRECK, Suppressor of tumorigenicity 15 protein, RECK, ST15, Application: WB, Size: 100ug/vial
Catalog Number: 76171-966
Supplier: Boster Biological Technology


Description: GPR2/CCR10 antibody, Polyclonal, Host: Rabbit IgG, Reactivity: Human, Mouse, Rat, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human GPR2/CCR10(312-327aa FLGLRFRQDLRRLLRG).
Catalog Number: 10206-404
Supplier: Boster Biological Technology


Description: EGF Polyclonal Antibody, Host: Rabbit, Species: Mouse, Isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of mouse EGF(1013-1029aa YSGDRCQTRDLRWWELR), Application: Western Blot, IHC-P
Catalog Number: 10207-500
Supplier: Boster Biological Technology


Description: Sandwich Picokine* ELISA kit of quantitative detection for human CCL27/CTACK Immunogen: E.coli, F25-G112 Assay range: 15.6pg/ml-1000pg/ml Sensitivity: < 10 pg/ml 96-well plate precoated Sample Type: cell culture supernates, serum and plasma(heparin, EDTA).
Catalog Number: 10208-800
Supplier: Boster Biological Technology


Description: ErbB 2 Picoband, Polyclonal Antibody, Host: Rabbit, Species: Human, Rat, Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human ErbB 2 29-64aa, Synonym: CD340, ERBB2, HER2, MLN19, NEU, NGL, Application: IHC-P, WB, Size:100ug
Catalog Number: 76170-744
Supplier: Boster Biological Technology


Description: ITGA7 Polyclonal Antibody, Host: Rabbit, Species: Human Mouse Rat, Isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human ITGA7(1123-1139aa HAV, Application: Western Blot
Catalog Number: 10207-034
Supplier: Boster Biological Technology


Description: JNK1 antibody, polyclonal, Host: Rabbit, Isotype: IgG, Species reactivity: Human, Mouse, Rat, Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human JNK1(1-15aa MSRSKRDNNFYSVEI), identical to the related rat and mouse sequences.Application: WB
Catalog Number: 10208-176
Supplier: Boster Biological Technology


Description: ARSA Monoclonal Antibody: Clone: 4C10), Host: Mouse, Reactivity: Human, Conjugate: DyLight* 488, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of ARSA (454-482aa), Alternative Names: Arylsulfatase A/ARSA, ARSA, Size: 50ug/vial
Catalog Number: 76467-858
Supplier: Boster Biological Technology


Description: MAP2 Picoband, Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Rat, Immunogen: E. Coli-derived human MAP2 recombinant protein (Position: Q64-L133), Synonym: Microtubule-associated protein 2, MAP-2, MAP2, Application: ELISA, WB, Size:100ug
Catalog Number: 76171-370
Supplier: Boster Biological Technology


Description: IL2 antibody, Polyclonal, Host: Rabbit, Reactivity: Mouse, Rabbit IgG, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of mouse IL2, Application: WB.
Catalog Number: 10210-022
Supplier: Boster Biological Technology


Description: PU.1/Spi1 Polyclonal Antibody, Host: Rabbit, Species Reactivity: Human, Mouse, Rat, Isotype: IgG, Immunogen: E.coli-derived human PU.1/Spi1 recombinant protein, Synonym: Transcription factor PU.1, Application: Immunohistochemistry-P, Size: 100ug/vial
Catalog Number: 76174-980
Supplier: Boster Biological Technology


Description: B2M ELISA Kit, Reactivity: Human, Sample Type: cell culture supernatants, serum, plasma, saliva, urine and human milk, Sample Volume: 100ul per well, Sensitivity: <10pg/ml, Assay Range: 156-10000pg/ml, Alternative Names: beta 2-Microglobulin, Size: 96wells/kit, with removable strips.
Catalog Number: 76466-514
Supplier: Boster Biological Technology


Description: Ku70 Picoband*, Polyclonal Antibody, Host: Rabbit, Species: Human, Isotype: IgG, Immunogen: 464-496aa AIVEKLRFTYRSDSFENPVLQQHFRNLEALALD, Synonyms: X-ray repair cross-complementing protein 6, 3.6.4.-, 4.2.99, Application: WB, IHC-P, Size: 100ug/vial
Catalog Number: 76173-906
Supplier: Boster Biological Technology


Description: Beta Arrestin 1 antibody, Polyclonal, Host: Rabbit IgG, Reactivity: Human, Mouse, Rat, Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human beta Arrestin 1(82-103aa ANVQSFPPAPEDKKPLTRLQER).
Catalog Number: 10206-298
Supplier: Boster Biological Technology


Description: Sandwich Picokine* ELISA kit of quantitative detection for human IGFBP7 Immunogen: NSO, D30-L282 Assay range: 625pg/ml-40, 000pg/ml Sensitivity: < 20 pg/ml 96-well plate precoated Sample Type: cell culture supernates, serum, plasma(heparin, EDTA) and urine.
Catalog Number: 10207-714
Supplier: Boster Biological Technology


1,361 - 1,376 of 5,847