You Searched For: BOSTER BIOLOGICAL TECHNOLOGY CO LTD


5,847  results were found

Sort Results

List View Easy View (new)
SearchResultCount:"5847"
Description: Picoband*Perilipin A Polyclonal antibody, Host: Rabbit, Species: Human, Mouse, Rat, Immunogen: Synthetic peptide corresponding to a sequence of human Perilipin A, Synonyms: Perilipin-1, Lipid droplet-associated protein, Uses: WB, Size: 100ug/vial
Catalog Number: 76171-792
Supplier: Boster Biological Technology


Description: P-Cadherin-3 CDH3 ELISA Kit, Reactivity: Rat, Sample Type: cell culture supernatants, serum, Sample Volume: 100ul per well, Sensitivity: <5pg/ml, Assay Range: 15.6-1000pg/ml, Size: 96wells/kit
Catalog Number: 76466-408
Supplier: Boster Biological Technology


Description: MCL1 Picoband* Polyclonal Antibody, Host: Rabbit, Species reactivity: Human, Mouse, Rat, Immunogen: E.coli-derived human MCL1 recombinant protein (M1-R350), Synonyms: Bcl-2-like protein 3, BCL2L3, mcl1/EAT;MCL1, Application: WB, size: 100ug/vial
Catalog Number: 76173-150
Supplier: Boster Biological Technology


Description: Tau antibody, Polyclonal, Host: Rabbit, Reactivity: Human, Rabbit IgG, Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human Tau, Application: WB.
Catalog Number: 10210-026
Supplier: Boster Biological Technology


Description: NGF Polyclonal Antibody, Host: Rabbit, Species: Human Mouse Rat, Isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human NGF, identical to the related rat sequence, and different from the related mouse sequence by one amino acid
Catalog Number: 10207-486
Supplier: Boster Biological Technology


Description: ACVR2B/Actr Iib Picoband* Polyclonal Antibody, Host: Rabbit, Reactivity: Human, Rat, Isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the C-term of human ACVR2B, Synonym: ACTR-IIB, ACVR2B, Application: WB, Size: 100ug/vial
Catalog Number: 76174-412
Supplier: Boster Biological Technology


Description: SOCS1 antibody, Polyclonal, Host: Rabbit IgG, Reactivity: Human, Mouse, Rat, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human SOCS1(197-211aa NPVLRDYLSSFPFQI), identical to the related mouse and rat sequences.
Catalog Number: 10206-770
Supplier: Boster Biological Technology


Description: Beta Arrestin 2 polyclonal antibody, Host: Rabbit, Species reactivity: Human, Mouse, Rat, isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Beta Arrestin 2(395-409aa RLKGMKDDDYDDQLC)
Catalog Number: 10209-160
Supplier: Boster Biological Technology


Description: S100A13 PicoKine* ELISA Kit, Sensitivity: <10pg/ml, Sample type: cell culture supernates, cell lysates, serum and plasma (heparin, EDTA), Species: Human, Assay: 15.6pg/ml, Sandwich High Sensitivity ELISA kit for Quantitative Detection, Size: 96wells/kit
Catalog Number: 76172-724
Supplier: Boster Biological Technology


Description: GJA3/Connexin 46 Picoband*, Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Rat, Isotype: IgG, Immunogen: 89-118aa TLIYLGHVLHIVRMEEKKKEREEEEQLKRE, Synonyms: Gap junction alpha-3 protein, Connexin-46, Cx46, GJA3, Size: 100ug/vial
Catalog Number: 76174-048
Supplier: Boster Biological Technology


Description: Sandwich PicoKine* ELISA kit of Quantitative Detection for Human CD244/2B4, Immunogen: NSO, C22-R221, Assay range: 62.5pg/ml-4000pg/ml, Sensitivity: < 10 pg/ml, Sample type: cell culture supernates, serum and plasma(heparin, EDTA), 96-well plate precoated
Catalog Number: 10205-492
Supplier: Boster Biological Technology


Description: HRPT2 Picoband*, Polyclonal Antibody, Host: Rabbit, Species: Human, Isotype: IgG, Immunogen: E.coli-derived human HRPT2 recombinant protein, Synonyms: CDC73, C1orf28, HRPT2, Application: WB, Purity: Immunogen affinity purified, Size: 100ug/vial
Catalog Number: 76173-930
Supplier: Boster Biological Technology


Description: CXCL16 antibody, polyclonal, Host: Rabbit, Isotype: IgG, Species reactivity: Mouse, Immunogen: A synthetic peptide corresponding to a sequence in the middle region of mouse CXCL16(103-116aa HGKSFHHQKHLPQA).Application: WB, IHC-P
Catalog Number: 10208-026
Supplier: Boster Biological Technology


Description: LILRA5 ELISA Kit, Sample Volume: 100ul per well, Reactivity: Human, Sensitivity: <10pg/ml, Assay Range: 93.7pg/ml-6000pg/ml, Immunogen: /StandardExpression system for standard: NSO, Immunogen: sequence: G42-R299, Alternative Names: LILRC1, LILRA5, LILRC10, Size: 96wells/kit, with removable strips.
Catalog Number: 76467-090
Supplier: Boster Biological Technology


Description: TAFI/CPB2 Picoband* Polyclonal Antibody, Host: Rabbit, Species Reactivity: Human, Isotype: IgG, Immunogen: E. Coli-derived human CPB2 recombinant protein, Synonym: Carboxypeptidase B2, Application: Western blot, IHC-P, ELISA, Size: 100ug/vial
Catalog Number: 76174-854
Supplier: Boster Biological Technology


Description: MBL2 ELISA Kit EZ-Set* (DIY Antibody Pairs), Sample Volume: 100ul per well, Reactivity: Mouse, Sensitivity: <10pg/ml, Assay Range: 312pg/ml-20000pg/ml, Immunogen: StandardExpression system : NSO, E19-D244 Alternative Names: Mbl2, COLEC1 COLEC1collectin-1, Size: For 5 plates, 96 wells each
Catalog Number: 76467-222
Supplier: Boster Biological Technology


1,281 - 1,296 of 5,847