You Searched For: BOSTER BIOLOGICAL TECHNOLOGY CO LTD


5,847  results were found

Sort Results

List View Easy View (new)
SearchResultCount:"5847"
Description: Annexin VI Polyclonal Antibody, Host: Rabbit, Reactivity: Human, Mouse, Rat, Isotype: IgG, Immunogen: E. Coli-derived human Annexin VI recombinant protein (Position: N395-L665), Alternative Names: Annexin A6, 67 kDa calelectrin, Annexin A6, annexin VI (p68), Annexin VI, Size: 100ug/vial
Catalog Number: 76465-232
Supplier: Boster Biological Technology


Description: STAT5b antibody, Polyclonal, Host: Rabbit IgG, Reactivity: Human, Mouse, Rat, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human STAT5b(767-787aa RRVEELLGRPMDSQWIPHAQS), identical to the related rat and mouse sequences.
Catalog Number: 10206-720
Supplier: Boster Biological Technology


Description: ABCG4 polyclonal antibody, Host: Rabbit, Species reactivity: Human, Mouse, Rat, isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human ABCG4(327-341aa AVQNGLCAMAEKKSS)
Catalog Number: 10209-658
Supplier: Boster Biological Technology


Description: DNER ELISA Kit, Sample Volume: 100ul per well, Reactivity: Rat, Sensitivity: <50pg/ml, Assay Range: 312pg/ml-20000pg/ml, Immunogen: /StandardExpression system for standard: NSO, Immunogen: sequence: A26-Y64900, Size: 96wells/kit, with removable strips.
Catalog Number: 76467-030
Supplier: Boster Biological Technology


Description: LBP Picoband, Polyclonal Antibody, Host: Rabbit, Species Reactivity: Human, Mouse, Rat, Immunogen: E.coli-derived human LBP recombinant protein (Position: L177-E446, Synonym: Lipopolysaccharide-binding protein, LBP, LBP, Application: WB, Size:100ug
Catalog Number: 76171-174
Supplier: Boster Biological Technology


Description: Frizzled 4 Picoband, Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Rat, Immunogen: A synthetic peptide corresponding to a sequence of human Frizzled 4 (QNLGYNVTKMPNLVGHELQTDAELQLTTFTPLIQY), Synonym: FZD4, Application: IHC-P, WB, Size:100ug
Catalog Number: 76171-582
Supplier: Boster Biological Technology


Description: POLB/Dna Polymerase Beta Picoband*, Polyclonal Antibody, Host: Rabbit, Species: Human, Isotype: IgG, Immunogen: E.coli-derived human POLB recombinant protein, Synonyms: DNA polymerase beta, 2.7.7.7, 4.2.99.-, POLB, Size: 100ug/vial
Catalog Number: 76174-480
Supplier: Boster Biological Technology


Description: JAB1 Picoband*, Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Rat, Isotype: IgG, Immunogen: E.coli-derived human JAB1 recombinant protein, Synonyms: Jun activation domain-binding protein 1, COPS5, CSN5, JAB1, Size: 100ug/vial
Catalog Number: 76173-848
Supplier: Boster Biological Technology


Description: ERAB Polyclonal Antibody* Polyclonal Antibody, Host: Rabbit, Species reactivity: Human, Mouse, Rat, Immunogen: E.coli-derived human ERAB recombinant protein (E48-P261), Synonyms: 1.1.1.35, Application: Western Blot, size: 100ug/vial
Catalog Number: 76173-506
Supplier: Boster Biological Technology


Description: Liver FABP/Fabp1 Polyclonal Antibody, Host: Rabbit, Reactivity: Mouse, Rat, Isotype: IgG, Immunogen: E. Coli-derived rat liver FABP recombinant protein (Position: M1-I127), Alternative Names: FABP1/L-FABP, FABP1, FABPL, fatty acid binding protein 1, liver, Applications: ELISA, Size: 100ug/vial
Catalog Number: 76464-906
Supplier: Boster Biological Technology


Description: JAM-C/JAM3 ELISA Kit, Sample Volume: 100ul per well, Reactivity: Mouse, Sensitivity: <10pg/ml, Assay Range: 31.2pg/ml-2000pg/ml, Immunogen: /StandardExpression system for standard: NSO, sequence: E30-N241, Alternative Name: JAM-C, CD323, JAM-2, JAM3, JAMC, Size: 96wells/kit, with removable strips.
Catalog Number: 76466-662
Supplier: Boster Biological Technology


Description: Sandwich PicoKine* ELISA kit of Quantitative Detection for Mouse TNFRSF13C/BAFFR, Immunogen: NSO, S10-A71, Assay range: 78pg/ml-5000pg/ml, Sensitivity: < 10 pg/ml, Sample type: cell culture supernates, serum and plasma(heparin, EDTA), 96-well plate precoated
Catalog Number: 10205-198
Supplier: Boster Biological Technology


Description: Talin 2 Picoband* Polyclonal Antibody, Host: Rabbit, Species Reactivity: Human, Mouse, Rat, Isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence in the middle region, Synonym: Talin-2, TLN2, KIAA0320, Application: WB, IHC-P, Size: 100ug/vial
Catalog Number: 76174-760
Supplier: Boster Biological Technology


Description: Sandwich PicoKine* ELISA kit of Quantitative Detection for Human Renin, Immunogen: NSO, L67-R406, Assay range: 31.2pg/ml-2000pg/ml, Sensitivity: < 10 pg/ml, Sample type: cell culture supernates, serum, plasma(heparin, EDTA) and urine, 96-well plate precoated
Catalog Number: 10205-674
Supplier: Boster Biological Technology


Description: Bovine TGF Beta 1 PicoKine* ELISA Kit, Sensitivity: <1pg/ml, Sample type: cell culture supernates, serum, plasma(EDTA) and urine, Species reactivity: Bovine, Assay Range: 15.6pg/ml, Sandwich High Sensitivity, Immunogen: A279-S390, Size: 96wells/kit
Catalog Number: 76172-144
Supplier: Boster Biological Technology


Description: HnRNP D/AUF1/HNRNPD Monoclonal Antibody, Clone: 4F3, Host: Mouse, Reactivity: Human, Mouse, Rat, Immunogen: E.coli-derived human hnRNP D/AUF1/HNRNPD recombinant protein (Position: E88-N246), Alternative Names: AUF1, AUF1A, Size: 100ug/vial
Catalog Number: 76467-966
Supplier: Boster Biological Technology


1,233 - 1,248 of 5,847