You Searched For: BOSTER BIOLOGICAL TECHNOLOGY CO LTD


5,847  results were found

Sort Results

List View Easy View (new)
SearchResultCount:"5847"
Description: TCP1 alpha Monoclonal Antibody: Clone: 2E7), Host: Mouse, Reactivity: Human, Conjugate: DyLight* 550, Immunogen: synthetic peptide corresponding to sequence at C-terminus (515-551aa), Alternative Names: CCT1T-complex protein 1 subunit a, Size: 50ug/vial
Catalog Number: 76467-850
Supplier: Boster Biological Technology


Description: AAK-1 Polyclonal Antibody, Host: Rabbit, Reactivity: C. Elegans, Size: 200ul/vial
Catalog Number: 76466-174
Supplier: Boster Biological Technology


Description: BMP15/Gdf 9B Picoband* Polyclonal Antibody, Host: Rabbit, Species reactivity: Human, Immunogen: E. Coli-derived human BMP15 recombinant protein (Q268-R392), Synonyms: Bone morphogenetic protein 15; BMP-15, Application: WB, size: 100ug/vial
Catalog Number: 76173-010
Supplier: Boster Biological Technology


Description: Galectin-1 PicoKine* ELISA Kit, Sensitivity: <15pg/ml, Sample type: cell culture supernates, cell lysates, serum and plasma (heparin, EDTA), Species: Human, Assay: 156pg/ml, Sandwich High Sensitivity ELISA kit for Quantitative Detection, Size: 96wells/kit
Catalog Number: 76172-216
Supplier: Boster Biological Technology


Description: FGG Picoband, Polyclonal Antibody, Host: Rabbit, Species Reactivity: Human, Mouse, Rat, Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human FGG (133-163aa), Synonym: FGG, PRO2061, Application: IHC-P, WB, Size:100ug
Catalog Number: 76171-170
Supplier: Boster Biological Technology


Description: SUR1 ABCC8 Polyclonal Antibody, Host: Rabbit, Reactivity: Human, Isotype: IgG, Conjugate: DyLight* 550, Immunogen: synthetic peptide corresponding to a sequence of human SUR1 (TIQREGTLKDFQ RSECQLFEHWKTLMNRQDQELEKETVTERKA Alternative Names: SUR1, ABC36, Application: Flow Cytometry, Size: 50ug/vial
Catalog Number: 76463-998
Supplier: Boster Biological Technology


Description: ACTN3 Polyclonal Antibody, Host: Rabbit, Reactivity: Human, Isotype: IgG, Conjugate: DyLight* 488, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human ACTN3 (574-617aa), different from the related mouse sequence Alternative Names: actinin, Size: 50ug/vial
Catalog Number: 76464-976
Supplier: Boster Biological Technology


Description: RSK1 p90 antibody, Polyclonal, Host: Rabbit IgG, Reactivity: Human, Mouse, Rat, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human RSK1 p90(721-735aa ILAQRRVRKLPSTTL), identical to the related rat and mouse sequences.
Catalog Number: 10206-590
Supplier: Boster Biological Technology


Description: CXCL7 EZ-Set* ELISA Kit (DIY Antibody Pairs), Species: Human, Sensitivity: <2pg/ml, Sample Type: cell culture supernates, cell lysates, tissue homogenates, serum and plasma (heparin, EDTA), Assay Range: 15.6pg/ml-1000pg/ml, Size: For 5 plates, 96 wells
Catalog Number: 76172-820
Supplier: Boster Biological Technology


Description: Sandwich Picokine* ELISA kit of quantitative detection for human BMP-5 Immunogen: NSO, A317-H454 Assay range: 156pg/ml-10, 000g/ml Sensitivity: < 10 pg/ml 96-well plate precoated Sample Type: cell culture supernates, serum and bone tissue.
Catalog Number: 10207-736
Supplier: Boster Biological Technology


Description: Sorbitol Dehydrogenase Polyclonal Antibody, Host: Rabbit, Reactivity: Human, Monkey, Mouse, Rat, Immunogen: E.coli-derived Sorbitol Dehydrogenase/SORD recombinant protein, Alternative Names: Sorbitol Dehydrogenase, EC 1.1.1, EC 1.1.1.14, L-iditol 2-dehydrogenase, Size: 100ug/vial
Catalog Number: 76465-714
Supplier: Boster Biological Technology


Description: Picoband*RNF186 Polyclonal antibody, Host: Rabbit, Species: Human, Immunogen: E. Coli-derived human RNF186 recombinant protein (Position: R86-L159), Synonyms: RING finger protein 186, RNF186, Application: ELISA, Western blot, Size: 100ug/vial
Catalog Number: 76172-066
Supplier: Boster Biological Technology


Description: Apolipoprotein CIII Picoband* Polyclonal Antibody, Host: Rabbit, Species reactivity: Human, Mouse, Rat, Immunogen: E. Coli-derived human Apolipoprotein CIII recombinant protein (S21-A99), Synonyms: Apo-CIII, Application: Western blot, size: 100ug/vial
Catalog Number: 76173-000
Supplier: Boster Biological Technology


Description: PAX8 Picoband, Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Rat, Immunogen: A synthetic peptide corresponding to a sequence of human PAX8 (RKHLRTDAFSQHHLEPLECPFERQHYPEAYASPSHTKGEQ), Synonym: Paired box protein Pax-8, PAX8, Application: WB, Size:100ug
Catalog Number: 76171-240
Supplier: Boster Biological Technology


Description: Calcitonin Picoband*, Polyclonal Antibody, Host: Rabbit, Species: Mouse, Rat, Isotype: IgG, Immunogen: 83-119aa SCNTATCVTHRLAGLLSRSGGVVKDNFVPTNVGSEAF, Synonyms: Calcitonin gene-related peptide 1, Alpha-type CGRP, Size: 100ug/vial
Catalog Number: 76174-712
Supplier: Boster Biological Technology


Description: TRIB2/Trb 2 Picoband*, Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Rat, Isotype: IgG, Immunogen: 175-211aa DLKLRKFIFKDEERTRVKLESLEDAYILRGDDDSLSD, Synonyms: Tribbles homolog 2, TRB-2, TRIB2, TRB2, Size: 100ug/vial
Catalog Number: 76174-640
Supplier: Boster Biological Technology


1,201 - 1,216 of 5,847