You Searched For: BOSTER BIOLOGICAL TECHNOLOGY CO LTD


5,847  results were found

Sort Results

List View Easy View (new)
SearchResultCount:"5847"
Description: ABCG5 polyclonal antibody, Host: Rabbit, Species reactivity: Human, isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human ABCG5(116-131aa NGRALRREQFQDCFSY).
Catalog Number: 10209-608
Supplier: Boster Biological Technology


Description: FITC conjugated goat mouse IgG secondary antibody. Application: FCM, IHC-P, IHC-F, ICC, Pack Size: 0.5mg
Catalog Number: 10208-944
Supplier: Boster Biological Technology


Description: BMP-9 PicoKine* ELISA Kit, Species: Mouse, Sensitivity: <10pg/ml, Sample Type: bone tissue, cell culture supernates, serum and plasma (heparin, EDTA), Assay Range: 15.6pg/ml-1000pg/ml, Size: 96wells/kit, with removable strips
Catalog Number: 76172-762
Supplier: Boster Biological Technology


Description: Sandwich Picokine* ELISA kit of quantitative detection for rat Endothelin Immunogen: please inquire Assay range: 3.9pg/ml-250pg/ml Sensitivity: < 0.5 pg/ml 96-well plate precoated Sample Type: cell culture supernates, serum and plasma(heparin, EDTA).
Catalog Number: 10207-682
Supplier: Boster Biological Technology


Description: HSPB2 antibody, Polyclonal, Host: Rabbit, Reactivity: Human, Mouse, RatRabbit IgG, Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human HSPB2, Application: IHC-F, ICC, WB.
Catalog Number: 10209-972
Supplier: Boster Biological Technology


Description: EGR2 polyclonal antibody, Host: Rabbit, Species reactivity: Human, Mouse, Rat, isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human EGR2(153-168aa TMSQTQPDLDHLYSPP), different from the related rat and mouse sequences by one amino acid.
Catalog Number: 10209-812
Supplier: Boster Biological Technology


Description: FE65 Picoband*, Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Rat, Isotype: IgG, Immunogen: 21-56aa ALSLPLPLHAAHNQLLNAKLQATAVGPKDLRSAMGE, Synonyms: Amyloid beta A4 precursor protein-binding family B member 1, Application: WB, IHC-P, Size: 100ug/vial
Catalog Number: 76174-184
Supplier: Boster Biological Technology


Description: Sandwich PicoKine* ELISA kit of Quantitative Detection for Human Placental Growth Factor, Immunogen: E.coli, A21-R149, Assay range: 15.6pg/ml -1000pg/ml, Sensitivity: >1pg/ml, Sample: cell culture supernates, serum, plasma and urine, 96-well plate precoated
Catalog Number: 10205-744
Supplier: Boster Biological Technology


Description: GRK2 Picoband, Polyclonal Antibody, Host: Rabbit, Species: Mouse, Rat, Immunogen: corresponding to a sequence of human GRK2 (DSDPELVQWKKELRDAYREAQQLVQRVPKMKNK), Synonym: Beta-adrenergic receptor kinase 1, Beta-ARK-1, G-protein coupled receptor kinase 2, Size:100ug
Catalog Number: 76171-450
Supplier: Boster Biological Technology


Description: ICAM1 Picoband* Polyclonal antibody, Host: Rabbit, Species Reactivity: Human, isotype: IgG, E.coli-derived human ICAM1 recombinant protein (Position: L214-P532). Human ICAM1 shares 52% and 48% amino acid (aa) sequences identity with mouse and rat ICAM1, respectively
Catalog Number: 10209-696
Supplier: Boster Biological Technology


Description: GLB1/Beta-galactosidase Polyclonal Antibody, Host: Rabbit, Reactivity: Mouse, Rat, Isotype: IgG, Immunogen: E.coli-derived rat GLB1/Beta-galactosidase recombinant protein (Position: R103-I646).0, Applications: ELISA, Flow Cytometry, IF, IHC-P, ICC, WB, Size: 100ug/vial
Catalog Number: 76464-652
Supplier: Boster Biological Technology


Description: Sandwich Picokine* ELISA kit of quantitative detection for mouse CD14 Immunogen: NSO, A18-P345 Assay range: 156pg/ml-10, 000pg/ml Sensitivity: < 10 pg/ml 96-well plate precoated Sample Type: cell culture supernates, serum and plasma(heparin, EDTA).
Catalog Number: 10207-862
Supplier: Boster Biological Technology


Description: RNA polymerase II RPB1/POLR2A Polyclonal Antibody, Host: Rabbit, Reactivity: Human, Mouse, Rat, Immunogen: E. Coli-derived POLR2A recombinant protein (Position: A1148-H1384). Alternative Names: RNA Polymerase II/POLR2A, DNA-directed RNA polymerase II largest subunit, Size: 100ug/vial
Catalog Number: 76464-104
Supplier: Boster Biological Technology


Description: TFPI Polyclonal Antibody, Host: Rabbit, Species: Human Mouse Rat, Isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human TFPI(261-280aa QECLRACKKGFIQRISKGGL), Application: Western Blot
Catalog Number: 10207-284
Supplier: Boster Biological Technology


Description: TIM 1 Polyclonal Antibody, Host: Rabbit, Species: Human, Isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human TIM 1(332-348aa IKALQNAVEKEVQAEDN), Application: Western Blot, IHC-P
Catalog Number: 10206-880
Supplier: Boster Biological Technology


Description: Sandwich PicoKine* ELISA kit of Quantitative Detection for Rat Lumican, Immunogen: NSO, Q19-N338, Assay range: 156pg/ml-10, 000pg/ml, Sensitivity: < 10 pg/ml, Sample type: cell culture supernates, serum and plasma(heparin), 96-well plate precoated
Catalog Number: 10205-676
Supplier: Boster Biological Technology


1,185 - 1,200 of 5,847