You Searched For: BOSTER BIOLOGICAL TECHNOLOGY CO LTD


5,847  results were found

Sort Results

List View Easy View (new)
SearchResultCount:"5847"
Description: TGF beta Receptor II antibody, Polyclonal, Host: Rabbit IgG, Reactivity: Human, Mouse, Rat, Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human TGF beta Receptor II(330-346aa KGNLQEYLTRHVISWED).
Catalog Number: 10206-102
Supplier: Boster Biological Technology


Description: Dystroglycan PicoKine* ELISA Kit, Species: Human, Sensitivity: <10pg/ml, Sample Type: cell culture supernates, serum, plasma, saliva and urine, Assay Range: 156pg/ml-10000pg/ml, Size: 96wells/kit, with removable strips
Catalog Number: 76172-770
Supplier: Boster Biological Technology


Description: PLCG 2/PLCG2 Polyclonal Antibody, Host: Rabbit, Reactivity: Human, Mouse, Rat, Immunogen: E. Coli-derived PLCG 2 recombinant protein (Position: R1201-V1258), Alternative Names: PLC-gamma 2, EC 3.1.4.11, Phosphoinositide phospholipase C-gamma-2, phospholipase C gamma 2, Size: 100ug/vial
Catalog Number: 76465-208
Supplier: Boster Biological Technology


Description: PAR2 Picoband*, Polyclonal Antibody, Host: Rabbit, Species: Human, Isotype: IgG, Immunogen: 349-383aa HDFRDHAKNALLCRSVRTVKQMQVSLTSKKHSRKS, Synonyms: PAR-2, Coagulation factor II receptor-like 1, Application: Western Blot, Size: 100ug/vial
Catalog Number: 76174-216
Supplier: Boster Biological Technology


Description: HEXA Polyclonal Antibody, Host: Rabbit, Species: Human, Isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human HEXA, different from the related mouse sequence by three amino acids, and from the related rat sequences by four amino acids
Catalog Number: 10207-276
Supplier: Boster Biological Technology


Description: GABRB3/Gaba A Receptor Beta 3 Picoband*, Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Rat, Isotype: IgG, Immunogen: 344-375aa EKTAKAKNDRSKSESNRVDAHGNILLTSLEVH, Synonyms: receptor subunit beta-3, Size: 100ug/vial
Catalog Number: 76174-046
Supplier: Boster Biological Technology


Description: BMP-2 Quick ELISA Kit, Reactivity: Rat, Sample Type: bone tissue, cell culture supernatants and serum, Sample Volume: 100ul per well, Sensitivity: <2pg/ml, Assay Range: 31.2pg/ml-2000pg/ml, Alternative Names: Bmp2, BDA2, Size: 96wells/kit, with removable strips.
Catalog Number: 76467-314
Supplier: Boster Biological Technology


Description: NFkB P105/P50 Picoband* Polyclonal Antibody, Host: Rabbit, Species reactivity: Human, Rat, Immunogen: E.coli-derived human NFkB p105/P50 recombinant protein (M1-Q360), Synonyms: Nuclear factor NF-kappa-B p105 subunit, Application: WB, size: 100ug/vial
Catalog Number: 76173-178
Supplier: Boster Biological Technology


Description: Hemopexin PicoKine* ELISA Kit, Sensitivity: <50pg/ml, Sample type: cell culture supernates, cell lysates, serum and plasma (heparin, EDTA), Species: Human, Assay: 3.12ng/ml, Sandwich High Sensitivity ELISA kit for Quantitative Detection, Size: 96wells/kit
Catalog Number: 76172-564
Supplier: Boster Biological Technology


Description: SLC12A6 polyclonal antibody, Host: Rabbit, Species reactivity: Human, Mouse, Rat, isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human SLC12A6(1060-1080aa QKAKSMEGFQDLLNMRPDQSN)
Catalog Number: 10209-478
Supplier: Boster Biological Technology


Description: Mouse IL10 Polyclonal antibody, Host: Rabbit, Species Reactivity: Mouse, isotype: IgG, E. coli-derived mouse IL-10 recombinant protein(Position: S19-S178), for Interleukin-10(IL10) detection. Tested with WB, ELISA in Mouse
Catalog Number: 10209-332
Supplier: Boster Biological Technology


Description: Prothrombin Picoband, Polyclonal Antibody, Host: Rabbit, Species Reactivity: Human, Immunogen: E. Coli-derived human Prothrombin recombinant protein (Position: Y97-R124), Synonym: Prothrombin, Application: ELISA, IHC-P, WB, Size:100ug
Catalog Number: 76170-768
Supplier: Boster Biological Technology


Description: GPI/Glucose 6 Phosphate Isomerase Picoband* Polyclonal Antibody, Host: Rabbit, Species reactivity: Human, Immunogen: synthetic peptide corresponding to a the N-terminus (5-39aa), Synonyms: GPI; 5.3.1.9, Application: WB, size: 100ug/vial
Catalog Number: 76173-050
Supplier: Boster Biological Technology


Description: IL4 antibody, Polyclonal, Host: Rabbit, Reactivity: Mouse, Rabbit IgG, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of mouse IL4, Application: WB.
Catalog Number: 10210-028
Supplier: Boster Biological Technology


Description: Neudesin ELISA Kit, Sample Volume: 100ul per well, Reactivity: Human, Sensitivity: <15pg/ml, Assay Range: 93.6pg/ml-6000pg/ml, Alternative Names: Neudesin, Cell immortalization-related protein 2, CIR2, CIR2cell growth-inhibiting protein 47, Size: 96wells/kit, with removable strips.
Catalog Number: 76466-780
Supplier: Boster Biological Technology


Description: VEGF-B PicoKine* ELISA Kit, Sensitivity: <2pg/ml, Sample type: cell culture supernates, serum and plasma(heparin), Species reactivity: Mouse, Assay Range: 31.2pg/ml, Sandwich High Sensitivity ELISA kit for Quantitative Detection, Size: 96wells/kit
Catalog Number: 76172-510
Supplier: Boster Biological Technology


1,137 - 1,152 of 5,847