You Searched For: BOSTER BIOLOGICAL TECHNOLOGY CO LTD


5,846  results were found

SearchResultCount:"5846"

Sort Results

List View Easy View (new)

Rate These Search Results

Catalog Number: (76174-360)
Supplier: Boster Biological Technology
Description: Rabbit IgG polyclonal antibody for Protein disulfide-isomerase A3(PDIA3) detection. Tested with WB, IHC-P, IHC-F in Human;Mouse;Rat.


Catalog Number: (76172-338)
Supplier: Boster Biological Technology
Description: Sandwich High Sensitivity ELISA kit for Quantitative Detection of Rat E-Cadherin


Catalog Number: (76173-518)
Supplier: Boster Biological Technology
Description: Rabbit IgG polyclonal antibody for Glucocorticoid receptor(NR3C1) detection. Tested with WB, IHC-P in Human;Mouse;Rat.


Catalog Number: (76171-772)
Supplier: Boster Biological Technology
Description: Rabbit IgG polyclonal antibody for Breast cancer metastasis-suppressor 1(BRMS1) detection. Tested with WB in Human;Mouse;Rat.


Catalog Number: (76174-678)
Supplier: Boster Biological Technology
Description: Rabbit IgG polyclonal antibody for Osteocalcin(BGLAP) detection. Tested with IHC-P in Rat.


Catalog Number: (76173-798)
Supplier: Boster Biological Technology
Description: Rabbit IgG polyclonal antibody for Pyrin(MEFV) detection. Tested with WB in Human;Rat.


Catalog Number: (76467-736)
Supplier: Boster Biological Technology
Description: 14-3-3 zeta/delta/YWHAZ Monoclonal Antibody, Clone: 6G5, Host: Mouse, Reactivity: Human, Monkey, Mouse, Rat, Immunogen: A synthetic peptide corresponding to a sequence of human 14-3-3 zeta/delta (LLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQ), Alternative Names: YWHAZ, 1433 zeta, Size: 100ug/vial


Catalog Number: (76172-602)
Supplier: Boster Biological Technology
Description: Sandwich High Sensitivity ELISA kit for Quantitative Detection of Mouse Persephin


Catalog Number: (76171-828)
Supplier: Boster Biological Technology
Description: Rabbit IgG polyclonal antibody for Stromelysin-3(MMP11) detection. Tested with WB, IHC-P in Human;Mouse;Rat.


Catalog Number: (76174-300)
Supplier: Boster Biological Technology
Description: Rabbit IgG polyclonal antibody for Protein S100-A8(S100A8) detection. Tested with WB, IHC-P in Mouse;Rat.


Catalog Number: (76171-274)
Supplier: Boster Biological Technology
Description: Rabbit IgG polyclonal antibody for Retinal-specific ATP-binding cassette transporter(ABCA4) detection. Tested with WB in Human;Mouse;Rat.


Catalog Number: (76172-994)
Supplier: Boster Biological Technology
Description: Rabbit IgG polyclonal antibody for Amiloride-sensitive amine oxidase [copper-containing](AOC1) detection. Tested with WB in Human;Rat.


Catalog Number: (76464-556)
Supplier: Boster Biological Technology
Description: Rabbit IgG polyclonal antibody for PRX detection. Tested with WB, IHC-F, ICC, FCM, Direct ELISA in Human;Mouse;Rat.


Catalog Number: (10205-892)
Supplier: Boster Biological Technology
Description: Rabbit IgG polyclonal antibody for Muscarinic acetylcholine receptor M2(CHRM2) detection. Tested with WB, IHC-P in Human; Mouse; Rat.


Catalog Number: (10208-772)
Supplier: Boster Biological Technology
Description: Sandwich ELISA kit of Quantitative Detection for Mouse TNFRSF14/HVEM


Catalog Number: (10206-564)
Supplier: Boster Biological Technology
Description: Rabbit IgG polyclonal antibody for Netrin-1(NTN1) detection. Tested with WB in Human;Mouse;Rat.


Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
In order to process your orders without delay, we request that you provide the required business documentation to purchase this product.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • State issued document with your organization's Federal Tax ID Number
  • State issued document with your organization's Resale Tax ID Number
  • City or County issued Business License
  • State Department of Health Services License
  • Any other ID issued by the State that includes the business name and address

* Please note if your account is within the State of California two of these pieces of identification will be required.
VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
1,137 - 1,152 of 5,846
no targeter for Bottom