You Searched For: BOSTER BIOLOGICAL TECHNOLOGY CO LTD


5,847  results were found

Sort Results

List View Easy View (new)
SearchResultCount:"5847"
Description: Agrin/AGRN Polyclonal Antibody, Host: Rabbit, Reactivity: Human, Mouse, Rat, Isotype: IgG, Immunogen: E.coli-derived human Agrin/AGRN recombinant protein (Position: S1864-P2068), Alternative Names: Agrin, agrin proteoglycan, Agrin, AGRN, Applications: WB, Size: 100ug/vial
Catalog Number: 76465-386
Supplier: Boster Biological Technology


Description: Diubiquitin polyclonal antibody, Host: Rabbit, Species reactivity: Human, isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human Diubiquitin(27-40aa YDSVKKIKEHVRSK)
Catalog Number: 10209-304
Supplier: Boster Biological Technology


Description: Sandwich PicoKine* ELISA kit of Quantitative Detection for Rat Neuropilin-2, Immunogen: NSO, Q23-D857, Assay range: 156pg/ml-10, 000pg/ml, Sensitivity: < 10 pg/ml, Sample type: cell culture supernates, cell lysates and tissue homogenates, 96-well plate precoated
Catalog Number: 10205-446
Supplier: Boster Biological Technology


Description: DARPP32 Picoband*, Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Rat, Isotype: IgG, Immunogen: 1-36aa MDPKDRKKIQFSVPAPPSQLDPRQVEMIRRRRPTPA, Synonyms: Protein phosphatase 1 regulatory subunit 1B, DARPP-32, Size: 100ug/vial
Catalog Number: 76174-598
Supplier: Boster Biological Technology


Description: Glutaredoxin 2 polyclonal antibody, Host: Rabbit, Species reactivity: Human, Mouse, Rat, isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human Glutaredoxin 2(103-119aa EYGNQFQDALYKMTGER)
Catalog Number: 10209-178
Supplier: Boster Biological Technology


Description: LTBR polyclonal antibody, Host: Rabbit, Species reactivity: Human, isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human LTBR(420-435aa ATPSNRGPRNQFITHD).
Catalog Number: 10209-798
Supplier: Boster Biological Technology


Description: IKK alpha Picoband* Polyclonal antibody, Host: Rabbit, Species Reactivity: Human, Mouse, Rat, isotype: IgG, E.coli-derived human IKK alpha recombinant protein (Position: V411-E745) Human IKK alpha shares 98% amino acid (aa) sequence identity with mouse IKK alpha
Catalog Number: 10209-320
Supplier: Boster Biological Technology


Description: TRIF Polyclonal Antibody, Host: Rabbit, Reactivity: Mouse, Isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of mouse TRIF (53-84aa), Synonym: TIR domain-containing adapter molecule 1, Application: WB, Size: 100 ug/vial
Catalog Number: 76174-986
Supplier: Boster Biological Technology


Description: MGMT Picoband* Polyclonal Antibody, Host: Rabbit, Species reactivity: Human, Immunogen: E.coli-derived human MGMT recombinant protein (D2-N207), Synonym: Methylated-DNA--protein-cysteine methyltransferase, Application: IHC-P, ICC, WB, size: 100ug/vial
Catalog Number: 76173-366
Supplier: Boster Biological Technology


Description: Serpin G1 ELISA Kit, Sample Volume: 100ul per well, Reactivity: Human, Sensitivity: <10pg/ml, Assay Range: 156pg/ml-10000pg/ml, Immunogen: StandardExpression system : NSO, sequence: N23-A500 Alternative Names: Serpin G1/C1 Inhibitor, C1 Inhibitor C1IN, Size: 96wells/kit, with removable strips.
Catalog Number: 76466-486
Supplier: Boster Biological Technology


Description: Human FGF2 Polyclonal antibody, Host: Rabbit, Species Reactivity: Human, isotype: IgG, E.coli-derived human FGF2 recombinant protein(Position: P143-S288), for Fibroblast growth factor 2(FGF2) detection. Tested with WB, IHC-P, ELISA, Neu, IP in Human
Catalog Number: 10209-328
Supplier: Boster Biological Technology


Description: SPOCK1/Testican-1 ELISA Kit, Reactivity: Human, Sample Type: cell culture supernatants, serum and plasma (heparin, EDTA), Sample Volume: 100ul per well, Sensitivity: <10pg/ml, Assay Range: 15.6-1000pg/ml, Alternative Names: Testican 1/SPOCK1, FLJ37170, Size: 96wells/kit, with removable strips.
Catalog Number: 76466-672
Supplier: Boster Biological Technology


Description: FGFBP1 ELISA Kit, Sample Volume: 100ul per well, Reactivity: Rat, Sensitivity: <10pg/ml, Assay Range: 78-5000pg/ml, Immunogen: StandardExpression system: NSO, sequence: E21-C238 Alternative Names: 17 kDa heparin-binding growth factor-binding protein, Size: 96wells/kit, with removable strips.
Catalog Number: 76466-520
Supplier: Boster Biological Technology


Description: Integrin beta 4 Picoband* antibody, Polyclonal, Host: Rabbit IgG, Reactivity: Human, Immunogen: E.coli-derived human Integrin beta 4 recombinant protein (Position: N28-A266).
Catalog Number: 10206-222
Supplier: Boster Biological Technology


Description: SDHB Picoband, Polyclonal Antibody, Host: Rabbit, Species Reactivity: Human, Mouse, Rat, Immunogen: E. Coli-derived human SDHB recombinant protein (Position: A29-V280), Synonym: Ip, SDHB, SDH, SDH1, Application: ELISA, IHC-P, WB, Size:100ug
Catalog Number: 76171-304
Supplier: Boster Biological Technology


Description: Sandwich Picokine* ELISA kit of quantitative detection for mouse MMP-3 Immunogen: NSO, Y18-C477 Assay range: 156pg/ml-10, 000pg/ml Sensitivity: < 10 pg/ml 96-well plate precoated Sample Type: cell culture supernates, serum and plasma(heparin).
Catalog Number: 10207-788
Supplier: Boster Biological Technology


1,105 - 1,120 of 5,847