You Searched For: BOSTER BIOLOGICAL TECHNOLOGY CO LTD


5,847  results were found

Sort Results

List View Easy View (new)
SearchResultCount:"5847"
Description: LXR alpha antibody, Polyclonal, Host: Rabbit IgG, Reactivity: Human, Mouse, Rat, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human LXR alpha(371-385aa NVQDQLQVERLQHTY), identical to the related rat and mouse sequences.
Catalog Number: 10206-468
Supplier: Boster Biological Technology


Description: CD59 Picoband, Polyclonal Antibody, Host: Rabbit, Species Reactivity: Mouse, Rat, Immunogen: E. Coli-derived mouse CD59 recombinant protein (Position: L24-S96), Synonym: MACIF, Protectin, CD59, Cd59a, Cd59, Application: ELISA, IHC-P, WB, Size:100ug
Catalog Number: 76171-230
Supplier: Boster Biological Technology


Description: CPT1B Picoband*, Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Rat, Isotype: IgG, Immunogen: 197-226aa DDEEYYRMELLAKEFQDKTAPRLQKYLVLK, Synonyms: Carnitine palmitoyltransferase I-like protein, CPT1B, KIAA1670, Size: 100ug/vial
Catalog Number: 76173-850
Supplier: Boster Biological Technology


Description: Bovine BMP-4 PicoKine* ELISA Kit, Sensitivity: <4pg/ml, Sample type: bone tissue and cell culture supernates, Species: Bovine, Assay Range: 62.5pg/ml, Sandwich High Sensitivity, With removable strips, Immunogen Sequence: S293-R408, Size: 96wells/kit
Catalog Number: 76171-910
Supplier: Boster Biological Technology


Description: Endostatin PicoKine* ELISA Kit, Sensitivity: <15pg/ml, Sample type: cell culture supernates, cell lysates, serum and plasma (heparin, EDTA), Species: Rat, Assay: 156pg/ml, Sandwich High Sensitivity ELISA kit for Quantitative Detection, Size: 96wells/kit
Catalog Number: 76172-468
Supplier: Boster Biological Technology


Description: RUNX1T1 Polyclonal Antibody, Host: Rabbit, Reactivity: Human, Mouse, Rat, Isotype: IgG, Immunogen: E. Coli-derived human RUNX1T1/ETO recombinant protein (Position: T335-D510), Alternative Names: RUNX1T1/ETO, AML1T1protein CBFA2T1, CBFA2T1Cyclin-D-related protein, CDRMGC2796, Size: 100ug/vial
Catalog Number: 76464-626
Supplier: Boster Biological Technology


Description: Picoband*Epigen Polyclonal antibody, Host: Rabbit, Species reactivity: Human, Rat, Immunogen: E. Coli-derived human Epigen recombinant protein, Synonyms: Epigen, Epithelial mitogen, EPG, EPGN, Application: WB, Storage: -20 to 4 deg C, Size: 100ug/vial
Catalog Number: 76172-042
Supplier: Boster Biological Technology


Description: Kininogen-1/KNG1 Polyclonal Antibody, Host: Rabbit, Species reactivity: Human, Immunogen: E.coli-derived human Kininogen 1 recombinant protein (Q19-N210), Synonyms: Kininogen-1, KNG1; BDK, KNG, Application: Western Blot, size: 100ug/vial
Catalog Number: 76173-390
Supplier: Boster Biological Technology


Description: Pan-Cadherin, monoclonal, Clone: PC-79, Host: Mouse, Isotype: IgG, Species reactivity: Human, mouse, rat, rabbit, chicken, snake, Immunogen: Synthetic peptide corresponding to the C-terminal amino acids N-Cadherin (24 amino acids) coupled to KLH.Application: WB, IHC-P
Catalog Number: 10207-916
Supplier: Boster Biological Technology


Description: HnRNP D/AUF1/HNRNPD Monoclonal Antibody, Clone: 4F3, Host: Mouse, Reactivity: Human, Mouse, Rat, Immunogen: E.coli-derived human hnRNP D/AUF1/HNRNPD recombinant protein (Position: E88-N246), Alternative Names: AUF1, AUF1A, Size: 100ug/vial
Catalog Number: 76467-966
Supplier: Boster Biological Technology


Description: Myosin(Skeletal, Slow) monoclonal antibody, Host: Mouse, Species Reactivity: Human, Mouse, Rabbit, Rat, IML-64, isotype: IgG1, Human skeletal muscle myosin purified from myofibrils
Catalog Number: 10209-462
Supplier: Boster Biological Technology


Description: Carbonic Anhydrase III antibody, Polyclonal, Host: Rabbit IgG, Reactivity: Human, Mouse, Rat, Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human Carbonic Anhydrase III(2-20aa AKEWGYASHNGPDHWHELF).
Catalog Number: 10206-008
Supplier: Boster Biological Technology


Description: Sandwich PicoKine* ELISA kit of Quantitative Detection for Human Renin, Immunogen: NSO, L67-R406, Assay range: 31.2pg/ml-2000pg/ml, Sensitivity: < 10 pg/ml, Sample type: cell culture supernates, serum, plasma(heparin, EDTA) and urine, 96-well plate precoated
Catalog Number: 10205-674
Supplier: Boster Biological Technology


Description: Bovine TGF Beta 1 PicoKine* ELISA Kit, Sensitivity: <1pg/ml, Sample type: cell culture supernates, serum, plasma(EDTA) and urine, Species reactivity: Bovine, Assay Range: 15.6pg/ml, Sandwich High Sensitivity, Immunogen: A279-S390, Size: 96wells/kit
Catalog Number: 76172-144
Supplier: Boster Biological Technology


Description: Sandwich PicoKine* ELISA kit of Quantitative Detection for Mouse CD22, Immunogen: NSO, S22-R702, Assay range: 156pg/ml-10, 000pg/ml, Sensitivity: < 10 pg/ml, Sample type: cell culture supernates, serum and plasma(heparin, EDTA), 96-well plate precoated
Catalog Number: 10205-804
Supplier: Boster Biological Technology


Description: BMP5 Polyclonal Antibody, Host: Rabbit, Reactivity: Human, Isotype: IgG, Conjugate: DyLight* 488, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human BMP5 (332-365aa HQDSSRMSSVGDYNTSEQKQACKKHELYVSFRDL) Alternative Names: BMP-5, BMP5, Size: 50ug/vial
Catalog Number: 76465-546
Supplier: Boster Biological Technology


97 - 112 of 5,847