You Searched For: BOSTER BIOLOGICAL TECHNOLOGY CO LTD


5,847  results were found

Sort Results

List View Easy View (new)
SearchResultCount:"5847"
Description: PILC Polyclonal Antibody, Host: Rabbit, Reactivity: Pseudomonas sp. HMSC065H01, Size: 500ul/vial
Catalog Number: 76466-200
Supplier: Boster Biological Technology


Description: BMPR1B antibody, Polyclonal, Host: Rabbit IgG, Reactivity: Human, Mouse, Rat, Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human BMPR1B(145-160aa FCYFRYKRQETRPRYS).
Catalog Number: 10206-738
Supplier: Boster Biological Technology


Description: ROC1 Picoband*, Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Rat, Isotype: IgG, Immunogen: 76-108aa NHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH, Synonyms: E3 ubiquitin-protein ligase RBX1, 6.3.2.-, Protein ZYP, Application: WB, Size: 100ug/vial
Catalog Number: 76174-452
Supplier: Boster Biological Technology


Description: Sandwich PicoKine* ELISA kit of Quantitative Detection for Mouse Angiopoietin-2, Immunogen: CHO, M1-F496, Assay range: 156pg/ml-10, 000pg/ml, Sensitivity: < 10 pg/ml, Sample type: cell culture supernates, serum and plasma(heparin, EDTA), 96-well plate precoated
Catalog Number: 10205-220
Supplier: Boster Biological Technology


Description: C-Myc antibody, Monoclonal, Host: Mouse IgG1, Clone number: IMD-3, Synonyms: C-Myc/bHLHe39/Proto-oncogene c-Myc/Transcription factor p64, Reactivity: Human, Immunogen: Synthetic peptide corresponding to residues 408-439 of the human p62c-Myc protein.
Catalog Number: 10206-122
Supplier: Boster Biological Technology


Catalog Number: 10207-566
Supplier: Boster Biological Technology


Description: TIMP-2, Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Rat, Isotype: IgG, Immunogen: E. Coli-derived human TIMP2 recombinant protein, Synonyms: Tissue inhibitor of metalloproteinases 2, TIMP-2, TIMP2, Application: WB, Size: 100ug/vial
Catalog Number: 76174-516
Supplier: Boster Biological Technology


Description: VEGF Receptor 2 Picoband, Polyclonal Antibody, Host: Rabbit, Species: Human, Immunogen: E. Coli-derived human VEGF Receptor 2 recombinant protein (Position: A20-L242), Synonym: KDR, FLK1, VEGFR2, Application: ELISA, IHC-P, WB, Size:100ug
Catalog Number: 76171-224
Supplier: Boster Biological Technology


Description: Pig Porcine GDF5 PicoKine* ELISA Kit, Sensitivity: <10pg/ml, Sample type: cell culture supernates, serum and plasma(heparin, EDTA), Species reactivity: Pig, Assay Range: 31.2pg/ml, Sandwich High Sensitivity, Immunogen: A376-R495, Size: 96wells/kit
Catalog Number: 76172-622
Supplier: Boster Biological Technology


Description: Sandwich PicoKine* ELISA kit of Quantitative Detection for Human TFF2, Immunogen: NSO, E24-Y129, Assay range: 7.8pg/ml-500pg/ml, Sensitivity: < 10 pg/ml, Sample type: cell culture supernates, serum and plasma(heparin, EDTA), 96-well plate precoated
Catalog Number: 10205-790
Supplier: Boster Biological Technology


Description: Sandwich Picokine* ELISA kit of quantitative detection for human HBEGF Immunogen: sf21, D63-L148 Assay range: 15.6pg/ml-1000pg/ml Sensitivity: < 10 pg/ml 96-well plate precoated Sample Type: cell culture supernates, serum and plasma(heparin, EDTA).
Catalog Number: 10207-830
Supplier: Boster Biological Technology


Description: Sandwich PicoKine* ELISA kit of Quantitative Detection for Human Thioredoxin, Immunogen: E.coli, V2-V105, Assay range: 156pg/ml-10, 000pg/ml, Sensitivity: < 10 pg/ml, Sample type: cell culture supernates, serum and plasma(heparin), 96-well plate precoated
Catalog Number: 10205-344
Supplier: Boster Biological Technology


Description: BNIP3 Picoband, Polyclonal Antibody, Host: Rabbit, Species Reactivity: Human, Mouse, Rat, Immunogen: A synthetic peptide corresponding to a sequence of human BNIP3 (KEFLFKHPKRTATLSMRNTSVMKK), Synonym: BNIP3, NIP3, Application: WB, Size:100ug
Catalog Number: 76171-446
Supplier: Boster Biological Technology


Description: FITC conjugated goat human IgM secondary antibody. Application: FCM, IHC-P, IHC-F, ICC. Pack Size: 0.5mg
Catalog Number: 10208-956
Supplier: Boster Biological Technology


Description: Sandwich Picokine* ELISA kit of quantitative detection for rat CD36/SR-B3 Immunogen: CHO, G30-K439 Assay range: 218pg/ml-14, 000pg/ml Sensitivity: < 10 pg/ml 96-well plate precoated Sample Type: cell culture supernates, serum and plasma(heparin, EDTA).
Catalog Number: 10208-996
Supplier: Boster Biological Technology


Description: Fibronectin ELISA Kit EZ-Set* (DIY Antibody Pairs), Sample Volume: 100ul per well, Reactivity: Human, Sensitivity: <10pg/ml, Assay Range: 156pg/ml-10000pg/ml, Immunogen: StandardExpression system for standard: from plasma Alternative Names: Fibronectin, CIG, ED-B, Size: For 5 plates, 96 wells each
Catalog Number: 76467-118
Supplier: Boster Biological Technology


993 - 1,008 of 5,847