You Searched For: BOSTER BIOLOGICAL TECHNOLOGY CO LTD


5,847  results were found

Sort Results

List View Easy View (new)
SearchResultCount:"5847"
Description: OPN Polyclonal Antibody, Host: Rabbit, Species Reactivity: Human, Mouse, Rat, Isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Osteopontin(281-314aa), Synonym: Osteopontin, Application: WB, ELISA, Size: 100ug/vial
Catalog Number: 76174-950
Supplier: Boster Biological Technology


Description: PLAC9 Polyclonal Antibody, Host: Rabbit, Reactivity: Human, Isotype: IgG, Immunogen: E. Coli-derived human PLAC9 recombinant protein (Position: R30-L81), Alternative Names: PLAC9, MGC104710, placenta-specific 9, placenta-specific protein 9, Applications: ELISA, WB, Size: 100ug/vial
Catalog Number: 76465-910
Supplier: Boster Biological Technology


Description: CD31 Picoband, Polyclonal Antibody, Host: Rabbit, Species: Mouse, Immunogen: E. Coli-derived mouse CD31 recombinant protein (Position: R58-Q273), Synonym: Platelet endothelial cell adhesion molecule, PECAM-1, CD31, Pecam1, Pecam, Pecam-1, Application: ELISA, WB, Size:100ug
Catalog Number: 76171-456
Supplier: Boster Biological Technology


Description: Estrogen Receptor Picoband* Polyclonal Antibody, Host: Rabbit, Species reactivity: Human, Immunogen: E.coli-derived human Estrogen Receptor recombinant protein (F425-V595), Synonyms: Estrogen receptor;, Application: IHC-P, WB, size: 100ug/vial
Catalog Number: 76173-250
Supplier: Boster Biological Technology


Description: MDMX Picoband*, Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Isotype: IgG, Immunogen: 35-72aa KILHAAGAQGEMFTVKEVMHYLGQYIMVKQLYDQQEQH, Synonyms: Protein Mdm4, Double minute 4 protein, Application: WB, IHC-P, Size: 100ug/vial
Catalog Number: 76174-584
Supplier: Boster Biological Technology


Description: Angiotensinogen antibody, Polyclonal, Host: Rabbit IgG, Reactivity: Mouse, Rat, Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of mouse Angiotensinogen(25-36aa DRVYIHPFHLLY), identical to the related rat sequence. Application: WB
Catalog Number: 10206-262
Supplier: Boster Biological Technology


Description: GSTA1/A2/A3/A4/A5 Picoband*, Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Rat, Isotype: IgG, Immunogen: 63-97aa MKLVQTRAILNYIASKYNLYGKDIKERALIDM YIE, Synonyms: Glutathione S-transferase A5, 2.5.1.18, Size: 100ug/vial
Catalog Number: 76174-110
Supplier: Boster Biological Technology


Description: PML Protein Picoband* Polyclonal Antibody, Host: Rabbit, Species reactivity: Mouse, Immunogen: synthetic peptide corresponding to a sequence at the N-terminus (140-177aa), Synonyms: Protein PML; Pml;, Application: WB, size: 100ug/vial
Catalog Number: 76173-084
Supplier: Boster Biological Technology


Description: Sandwich PicoKine* ELISA kit of Quantitative Detection for Human PD-1, Immunogen: NSO, L25-Q167, Assay range: 156pg/ml-10, 000pg/ml, Sensitivity: < 10 pg/ml, Sample type: cell culture supernates, 96-well plate precoated
Catalog Number: 10205-774
Supplier: Boster Biological Technology


Description: Monkey Primate BMP-2 PicoKine* ELISA Kit, Sensitivity: <2pg/ml, Sample type: bone tissue, cell culture supernates and serum, Species reactivity: Monkey, Assay Range: 31.2pg/ml, Sandwich High Sensitivity, Immunogen: Q283-R396, Size: 96wells/kit
Catalog Number: 76171-904
Supplier: Boster Biological Technology


Description: Sandwich PicoKine* ELISA kit of Quantitative Detection for Human soluble CD6, Immunogen: NSO, H18-E398, Assay range: 156pg/ml-10, 000pg/ml, Sensitivity: < 10 pg/ml, Sample type: cell culture supernates, serum and plasma(heparin, EDTA), 96-well plate precoated
Catalog Number: 10205-340
Supplier: Boster Biological Technology


Description: BAFF Receptor/TNFRSF13C Polyclonal Antibody, Host: Rabbit, Reactivity: Human, Mouse, Rat, Isotype: IgG, Immunogen: E. Coli-derived human BAFF Receptor recombinant protein (Position: M1-L78), Alternative Names: BAFFR/TNFRSF13C, BAFF R, BAFFR, BR3, CD268, Applications: ELISA, WB, Size: 100ug/vial
Catalog Number: 76465-036
Supplier: Boster Biological Technology


Description: Mesothelin Picoband* Polyclonal Antibody, Host: Rabbit, Species reactivity: Human, Immunogen: E.coli-derived human Mesothelin recombinant protein (K306-L576), Synonyms: Mesothelin; CAK1 antigen, Application: Western blot, size: 100ug/vial
Catalog Number: 76173-408
Supplier: Boster Biological Technology


Description: Sandwich PicoKine* ELISA kit of Quantitative Detection for Human CD26/DPP4, Immunogen: NSO, D34-P766, Range: 312pg/ml -20, 000pg/ml, Sensitivity: > 10 pg/ml, Sample type: cell culture supernates, serum, plasma(heparin, EDTA), saliva and urine, 96-well plate precoated
Catalog Number: 10205-474
Supplier: Boster Biological Technology


Description: HOXA4 Polyclonal Antibody, Host: Rabbit, Species: Human Mouse Rat, Isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human HOXA4(9-26aa NSNYIEPKFPPFEEYAQH), different from the related mouse sequence by two amino acids
Catalog Number: 10206-872
Supplier: Boster Biological Technology


Description: Sandwich PicoKine* ELISA kit of Quantitative Detection for Human Resistin, Immunogen: E.coli, K19-P108, Assay range: 78pg/ml-5, 000pg/ml, Sensitivity: < 3 pg/ml, Sample type: cell culture supernates, serum and plasma(heparin, EDTA), 96-well plate precoated
Catalog Number: 10205-532
Supplier: Boster Biological Technology


81 - 96 of 5,847