You Searched For: BOSTER BIOLOGICAL TECHNOLOGY CO LTD


5,847  results were found

Sort Results

List View Easy View (new)
SearchResultCount:"5847"
Description: TREM1 Picoband, Polyclonal Antibody, Host: Rabbit, Species: Mouse, Rat, Immunogen: E. Coli-derived mouse TREM1 recombinant protein (Position: A21-S202), Synonym: Triggering receptor expressed on myeloid cells 1, TREM-1, CD354, Trem1, Application: ELISA, WB, Size:100ug
Catalog Number: 76171-570
Supplier: Boster Biological Technology


Description: AIF Picoband* Polyclonal Antibody, Host: Rabbit, Species reactivity: Human, Mouse, Rat, Immunogen: synthetic peptide corresponding to a sequence at the C-terminus (582-613aa), Synonyms: Apoptosis-inducing factor 1, mitochondrial, Application: WB, size: 100ug/vial
Catalog Number: 76173-566
Supplier: Boster Biological Technology


Description: AGRP/Agouti-Related PicoKine* ELISA Kit, Sensitivity: <4pg/ml, Sample: cell culture supernates, serum, plasma (heparin, EDTA, citrate), urine, Species: Human, Assay: 7.8pg/ml, Sandwich High Sensitivity for Quantitative Detection, Size: 96wells/kit
Catalog Number: 76172-326
Supplier: Boster Biological Technology


Description: Monkey Primate Thrombomodulin PicoKine* ELISA Kit, Sensitivity: <10pg/ml, Sample type: cell culture supernates, serum, plasma and urine, Species reactivity: Monkey, Assay Range: 62.5pg/ml, Sandwich High Sensitivity, Size: 96wells/kit
Catalog Number: 76172-260
Supplier: Boster Biological Technology


Description: SLC26A4 Polyclonal Antibody, Host: Rabbit, Reactivity: Human, Mouse, Rat, Isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence of human SLC26A4 (RSLRVIVKEFQRIDVNVYFASLQDYVIEKLEQ), Alternative Names: SLC26A4, DFNB4, EVA, PDSTDH2B, pendrin, Applications: WB, Size: 100ug/vial
Catalog Number: 76464-010
Supplier: Boster Biological Technology


Description: HIF3 Polyclonal Antibody, Host: Rabbit, Species: Human Mouse Rat, Isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human HIF3(497-514aa DDDFQLNASEQLPRAYHR), different from the related rat and mouse sequences by five amino acids
Catalog Number: 10207-402
Supplier: Boster Biological Technology


Description: PMP70 Polyclonal Antibody, Host: Rabbit, Species: Human Mouse Rat, Isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human PMP70(646-659aa EFKQITEDTVEFGS), different from the related mouse and rat sequences by one amino acid
Catalog Number: 10207-004
Supplier: Boster Biological Technology


Description: Serotonin transporter antibody, Polyclonal, Host: Rabbit IgG, Reactivity: Rat, Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of rat Serotonin transporter(7-24aa NSQKVLSECKDREDCQEN).
Catalog Number: 10206-052
Supplier: Boster Biological Technology


Description: ATG14L Picoband*, Polyclonal Antibody, Host: Rabbit, Species: Human, Rat, Isotype: IgG, Immunogen: 70-101aa RDRERFIDKKERLSRLKSKQEEFQKEVLKAME, Synonyms: Beclin 1-associated autophagy-related key regulator, Application: WB, IHC-P, Size: 100ug/vial
Catalog Number: 76173-830
Supplier: Boster Biological Technology


Description: HDAC11/Histone Deacetylase 11 Picoband*, Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Rat, Isotype: IgG, Immunogen: 47-81aa NFLKEEKLLSDSMLVEAREASEEDLLVVHTRRYLN, Synonyms: Histone deacetylase 11, Size: 100ug/vial
Catalog Number: 76174-116
Supplier: Boster Biological Technology


Description: Bestrophin BEST1 Polyclonal Antibody, Host: Rabbit, Reactivity: Human, Isotype: IgG, Conjugate: DyLight* 550, Immunogen: A synthetic peptide corresponding to a sequence of Bestrophin, Alternative Names: Bestrophin 1, ARB, Best disease, BEST, bestrophin 1, Size: 50ug/vial
Catalog Number: 76464-386
Supplier: Boster Biological Technology


Description: CD45 Picoband*, Polyclonal Antibody, Host: Rabbit, Species: Human, Isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human CD45(1214-1254aa EQYQFLYDVIASTYPAQNGQVKKNNHQEDKIEFDNEVDKVK, Size: 100ug/vial
Catalog Number: 76174-386
Supplier: Boster Biological Technology


Description: Interferon gamma antibody, polyclonal, Host: Rabbit, Isotype: IgG, Species reactivity: Human, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human IFNG(151-166aa KRKRSQMLFRGRRASQ).Application: WB
Catalog Number: 10207-958
Supplier: Boster Biological Technology


Description: Picoband*HOXB1 Polyclonal antibody, Host: Rabbit, Species reactivity: Human, Mouse, Rat, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human HOXB1, Synonyms: Homeobox protein Hox-B1, Application: WB, Size: 100ug/vial
Catalog Number: 76171-844
Supplier: Boster Biological Technology


Description: SULT2A1 Picoband*, Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Rat, Isotype: IgG, Immunogen: 253-285aa DWKNHFTVAQAEDFDKLFQEKMADLPRELFPWE, Synonyms: ST2, ST2A3, Hydroxysteroid Sulfotransferase, HST, storage: -20 deg C, size: 100ug/vial
Catalog Number: 76174-498
Supplier: Boster Biological Technology


Description: Unconjugated Goat IgG secondary antibody. Application: ELISA, IF, IHC-P, IHC-F, ICC, WB. Pack Size: 1mg
Catalog Number: 10208-974
Supplier: Boster Biological Technology


913 - 928 of 5,847