You Searched For: BOSTER BIOLOGICAL TECHNOLOGY CO LTD


5,847  results were found

Sort Results

List View Easy View (new)
SearchResultCount:"5847"
Description: NUP98 Picoband* Polyclonal Antibody, Host: Rabbit, Species reactivity: Human, Mouse, Rat, Immunogen: E.coli-derived human NUP98 recombinant protein (H549-F880), Synonyms: Nup96; NUP98; ADAR2, Form: Lyophilised, Application: WB, size: 100ug/vial
Catalog Number: 76173-438
Supplier: Boster Biological Technology


Description: Sclerostin/SOST PicoKine* ELISA Kit, Sensitivity: <10pg/ml, Sample type: cell culture supernates, cell lysates, serum and plasma (heparin, EDTA), Species: Rat, Assay: 15.6pg/ml, Sandwich High Sensitivity for Quantitative Detection, Size: 96wells/kit
Catalog Number: 76172-718
Supplier: Boster Biological Technology


Description: Sandwich PicoKine* ELISA kit of Quantitative Detection for Human IL1RL1/ST2, Immunogen: NSO, K19-S328, Assay range: 156pg/ml-10, 000pg/ml, Sensitivity: < 10 pg/ml, Sample type: cell culture supernates, serum and plasma(heparin, EDTA), 96-well plate precoated
Catalog Number: 10205-418
Supplier: Boster Biological Technology


Description: DNER ELISA Kit, Sample Volume: 100ul per well, Reactivity: Human, Sensitivity: <50pg/ml, Assay Range: 312pg/ml-20000pg/ml, Alternative Names: DNER, bet, delta and Notch-like epidermal growth factor-related receptor, delta/notch-like EGF repeat containing, Size: 96wells/kit, with removable strips.
Catalog Number: 76467-026
Supplier: Boster Biological Technology


Description: Cdk4 Picoband*, Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Rat, Isotype: IgG, Immunogen: E.coli-derived human Cdk4 recombinant protein, Synonyms: Cyclin-dependent kinase 4, 2.7.11.22, Application: WB, IHC-P, Size: 100ug/vial
Catalog Number: 76173-936
Supplier: Boster Biological Technology


Description: CXCL10/IP-10, Polyclonal Antibody, Host: Rabbit, Species: Mouse, Isotype: IgG, Immunogen: E. Coli-derived mouse IP10 recombinant protein, Synonyms: C-X-C motif chemokine 10, 10 kDa interferon gamma-induced protein, Application: WB, ELISA, Size: 100ug/vial
Catalog Number: 76174-208
Supplier: Boster Biological Technology


Description: Bik Picoband*, Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Rat, Isotype: IgG, Immunogen: E.coli-derived human Bik recombinant protein, Synonyms: Bcl-2-interacting killer, Apoptosis inducer NBK, Application: WB, IHC-P, Size: 100ug/vial
Catalog Number: 76174-326
Supplier: Boster Biological Technology


Description: Mast Cell Tryptase Picoband* Polyclonal Antibody, Host: Rabbit, Species reactivity: Human, Immunogen: E. Coli-derived human Mast Cell Tryptase recombinant protein (H65-P275), Synonyms: Tryptase I; Tryptase alpha-1, Application: WB, size: 100ug/vial
Catalog Number: 76172-914
Supplier: Boster Biological Technology


Description: Sandwich PicoKine* ELISA kit of Quantitative Detection for Human Rantes, Immunogen: E.coli, S24-S91, Range: 15.6pg/ml -1000pg/ml, Sensitivity: > 3 pg/ml, Sample type: cell culture supernates, serum, plasma(heparin, EDTA, citrate) and urine, 96-well plate precoated
Catalog Number: 10205-612
Supplier: Boster Biological Technology


Description: Monkey Primate NGF/NGF Beta PicoKine* ELISA Kit, Sensitivity: <1pg/ml, Sample type: cell culture supernates and serum, Species reactivity: Monkey, Assay Range: 15.6pg/ml, Sandwich High Sensitivity, Immunogen: S122-A241, Size: 96wells/kit
Catalog Number: 76172-114
Supplier: Boster Biological Technology


Description: IL17C Picoband, Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Immunogen: E. Coli-derived human IL17C recombinant protein (Position: H19-V197), Synonym: Interleukin-17C, IL-17C, Cytokine CX2, IL17C, UNQ561/PRO1122, Application: ELISA, WB, Size:100ug
Catalog Number: 76170-828
Supplier: Boster Biological Technology


Description: Heparanase 1 Picoband* Polyclonal Antibody, Host: Rabbit, Species reactivity: Human, Rat, Immunogen: syntic peptide corresponding to a sequence in middle region (301-331aa), Synonyms: Heparanase; 3.2.1.166, Application: WB, size: 100ug/vial
Catalog Number: 76173-686
Supplier: Boster Biological Technology


Description: MMP-9, Polyclonal Antibody, Host: Rabbit, Species: Mouse, Rat, Isotype: IgG, Immunogen: 641-672aa KALLFSKGRVWRFDLKSQKVDPQSVIRVDKEF, Synonyms: Matrix metalloproteinase-9, MMP-9, 3.4.24.35, 92 kDa gelatinase, Application: WB, IHC-P, ELISA, Size: 100ug/vial
Catalog Number: 76173-802
Supplier: Boster Biological Technology


Description: Angiopoietin-1 ELISA Kit EZ-Set* (DIY Antibody Pairs), Sample Volume: 100ul per well, Reactivity: Rat, Sensitivity: <10pg/ml, Assay Range: 156pg/ml-10000pg/ml, Immunogen: StandardExpression system : NSO, H16-F498 Alternative Names: Angiopoietin-1, AGP1 AGPT, Size: For 5 plates, 96 wells each
Catalog Number: 76467-254
Supplier: Boster Biological Technology


Description: SNAI3 Picoband* Polyclonal Antibody, Host: Rabbit, Species reactivity: Human, Immunogen: syntic peptide corresponding to a sequence in middle region of human SNAI3 (155-178aa), Synonyms: Zinc finger protein SNAI3, Application: WB, size: 100ug/vial
Catalog Number: 76173-712
Supplier: Boster Biological Technology


Description: Sandwich PicoKine* ELISA kit of Quantitative Detection for Human LOX-1/OLR1, Immunogen: NSO, S61-Q273, Assay range: 31.2pg/ml-2000pg/ml, Sensitivity: < 10 pg/ml, Sample type: cell culture supernates, serum and plasma(heparin, EDTA), 96-well plate precoated
Catalog Number: 10205-396
Supplier: Boster Biological Technology


865 - 880 of 5,847