You Searched For: BOSTER BIOLOGICAL TECHNOLOGY CO LTD


5,847  results were found

Sort Results

List View Easy View (new)
SearchResultCount:"5847"
Description: WASP Picoband*, Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Rat, Isotype: IgG, Immunogen: 129-156aa ADEDEAQAFRALVQEKIQKRNQRQSGDR, Synonyms: Wiskott-Aldrich syndrome protein, WASp, WAS, IMD2, Application: WB, IHC-P, IHC-F, ICC, Size: 100ug/vial
Catalog Number: 76173-748
Supplier: Boster Biological Technology


Description: YB1 antibody, Polyclonal, Host: Rabbit, Reactivity: Human, Mouse, Rat, Rabbit IgG, Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human YB1, Application: WB.
Catalog Number: 10210-054
Supplier: Boster Biological Technology


Description: Podoplanin/gp36 antibody, Polyclonal, Host: Rabbit IgG, Reactivity: Mouse, Rat, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of rat Podoplanin/gp36(155-166aa VVMRKISGRFSP).
Catalog Number: 10206-266
Supplier: Boster Biological Technology


Description: SUR1 Picoband, Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Rat, Immunogen: A synthetic peptide corresponding to a sequence of human SUR1 (TIQREGTLKDFQRSECQLFEHWKTLMNRQDQELEKETVTERKA), Synonym: SUR1, Application: Flow Cytometry, IHC-F, ICC, WB, Size:100ug
Catalog Number: 76171-220
Supplier: Boster Biological Technology


Description: Monoamine Oxidase A polyclonal antibody, Host: Rabbit, Species reactivity: Human, isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human Monoamine Oxidase A(51-69aa RTYTIRNEHVDYVDVGGAY)
Catalog Number: 10209-142
Supplier: Boster Biological Technology


Description: Sandwich PicoKine* ELISA kit of Quantitative Detection for Human TFF3, Immunogen: E.coli, E22-Y80, Assay range: 15.6pg/ml-1000pg/ml, Sensitivity: > 10 pg/ml, Sample type: cell culture supernates, serum, plasma(heparin, EDTA), saliva and urine, 96-well plate precoated
Catalog Number: 10205-792
Supplier: Boster Biological Technology


Description: MGMT Picoband* Polyclonal Antibody, Host: Rabbit, Species reactivity: Human, Immunogen: E.coli-derived human MGMT recombinant protein (D2-N207), Synonym: Methylated-DNA--protein-cysteine methyltransferase, Application: IHC-P, ICC, WB, size: 100ug/vial
Catalog Number: 76173-366
Supplier: Boster Biological Technology


Description: SPOCK1/Testican-1 ELISA Kit, Reactivity: Human, Sample Type: cell culture supernatants, serum and plasma (heparin, EDTA), Sample Volume: 100ul per well, Sensitivity: <10pg/ml, Assay Range: 15.6-1000pg/ml, Alternative Names: Testican 1/SPOCK1, FLJ37170, Size: 96wells/kit, with removable strips.
Catalog Number: 76466-672
Supplier: Boster Biological Technology


Description: FGFBP1 ELISA Kit, Sample Volume: 100ul per well, Reactivity: Rat, Sensitivity: <10pg/ml, Assay Range: 78-5000pg/ml, Immunogen: StandardExpression system: NSO, sequence: E21-C238 Alternative Names: 17 kDa heparin-binding growth factor-binding protein, Size: 96wells/kit, with removable strips.
Catalog Number: 76466-520
Supplier: Boster Biological Technology


Description: Integrin beta 4 Picoband* antibody, Polyclonal, Host: Rabbit IgG, Reactivity: Human, Immunogen: E.coli-derived human Integrin beta 4 recombinant protein (Position: N28-A266).
Catalog Number: 10206-222
Supplier: Boster Biological Technology


Description: BCL2L2 antibody, Polyclonal, Host: Rabbit, Reactivity: Human, Mouse, RatRabbit IgG, Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human BCL2L2, Application: IHC-P, WB.
Catalog Number: 10209-954
Supplier: Boster Biological Technology


Description: MGA Picoband*, Polyclonal Antibody, Host: Rabbit, Species: Human, Isotype: IgG, Immunogen: 2376-2415aa QKEAEAFAYYRRTHTANERRRRGEMRDLFEKLKITLGLLH, Synonyms: mAX gene-associated protein, MAX dimerization protein 5, Application: WB, Size: 100ug/vial
Catalog Number: 76174-586
Supplier: Boster Biological Technology


Description: FLT3/FLK2 ELISA Kit, Sample Volume: 100ul per well, Reactivity: Human, Sensitivity: <50pg/ml, Assay Range: 62.5pg/ml-4000pg/ml, Alternative Names: Flt-3/Flk-2/CD135, CD135 antigen, CD135, EC 2.7.10, fetal liver kinase 2, Size: 96wells/kit, with removable strips.
Catalog Number: 76466-350
Supplier: Boster Biological Technology


Description: Sandwich Picokine* ELISA kit of quantitative detection for human Furin Immunogen: NSO, D108-E715 Assay range: 312pg/ml-20, 000pg/ml Sensitivity: < 10 pg/ml 96-well plate precoated Sample Type: cell culture supernates, tissue homogenates and cell lysates.
Catalog Number: 10207-846
Supplier: Boster Biological Technology


Description: SLC16A4 polyclonal antibody, Host: Rabbit, Species reactivity: Human, Mouse, Rat, isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human SLC16A4(134-148aa VVTTKYFKKRLALST)
Catalog Number: 10209-486
Supplier: Boster Biological Technology


Description: KLF4 Polyclonal Antibody, Host: Rabbit, Species: Human, Isotype: IgG, Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human KLF4(93-108aa RRETEEFNDLLDLDFI), identical to the related mouse and rat sequences, Application: Western Blot, IHC-P
Catalog Number: 10207-418
Supplier: Boster Biological Technology


817 - 832 of 5,847